Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.28
PubTator Score 8.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6685 1.7e-10
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Gastric adenocarcinoma 2 3.902 2.0
Colon adenoma 5 3.154 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 1.7e-10

Gene RIF (4)

PMID Text
22307328 human alpha1,4-N-acetylglucosaminyltransferase (alpha4GnT) is responsible for O-glycan biosynthesis and has a role in preventing gastric cancer by inhibiting H. pylori infection and also suppressing tumor-promoting inflammation
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19751437 Observational study of gene-disease association. (HuGE Navigator)
16441422 Up-regulation of alpha-1,4-N-acetylglucosaminyltransferase is associated with pancreatic cancer

AA Sequence

MRKELQLSLSVTLLLVCGFLYQFTLKSSCLFCLPSFKSHQGLEALLSHRRGIVFLETSERMEPPHLVSCS      1 - 70
VESAAKIYPEWPVVFFMKGLTDSTPMPSNSTYPAFSFLSAIDNVFLFPLDMKRLLEDTPLFSWYNQINAS     71 - 140
AERNWLHISSDASRLAIIWKYGGIYMDTDVISIRPIPEENFLAAQASRYSSNGIFGFLPHHPFLWECMEN    141 - 210
FVEHYNSAIWGNQGPELMTRMLRVWCKLEDFQEVSDLRCLNISFLHPQRFYPISYREWRRYYEVWDTEPS    211 - 280
FNVSYALHLWNHMNQEGRAVIRGSNTLVENLYRKHCPRTYRDLIKGPEGSVTGELGPGNK              281 - 340
//

Text Mined References (11)

PMID Year Title
22307328 2012 Essential role of gastric gland mucin in preventing gastric cancer in mice.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19751437 2009 Genetic variation in a4GnT in relation to Helicobacter pylori serology and gastric cancer risk.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16441422 2006 Clinical utility of quantitative RT-PCR targeted to alpha1,4-N-acetylglucosaminyltransferase mRNA for detection of pancreatic cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12594234 2003 Usefulness of the real-time reverse transcription-polymerase chain reaction assay targeted to alpha1,4-N-acetylglucosaminyltransferase for the detection of gastric cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11304796 2001 Immunohistochemical demonstration of alpha1,4-N-acetylglucosaminyltransferase that forms GlcNAcalpha1,4Galbeta residues in human gastrointestinal mucosa.
10430883 1999 Expression cloning of a human alpha1, 4-N-acetylglucosaminyltransferase that forms GlcNAcalpha1-->4Galbeta-->R, a glycan specifically expressed in the gastric gland mucous cell-type mucin.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.