Property Summary

NCBI Gene PubMed Count 7
PubMed Score 309.34

Knowledge Summary

Patent

No data available

Synonym

Accession A4D2B8 Q0VGD2 Q13400 Q16530 Q6NVZ2 Q7KZ90
Symbols PMS3
PMS8
PMSR1
PMSR2
PMS2L1
PMS2L6
PMS2L7
PMS2L8
PMS2L13

Gene

 GO Component (1)

AA Sequence

MVTMCGGHRPENFLHQVLTEFGEELAGEGKSEVGGGAPRSYLQVASAECWAAAPAVHVGEPVHAGGLHTE      1 - 70
RGADPVIGLYLVHRGGACQTPTVGNRQTPTLGIHARPRRRATTSLLTLLLAFGKNAVRCALIGPGSLTSR     71 - 140
TRPLTEPLGEKERREVFFPPRPERVEHNVESSRWEPRRRGACGSRGGNFPSPRGGSGVASLERAESSSTE    141 - 210
PAKAIKPIDRKSVHQICSGPVVPSLSTAVKELVENSLDAGATNIDLKLKDYGVDLIEVSGNGCGVEEENF    211 - 280
EGLTLKHHTSKIQEFADLPQVETFGFRGEALSSLCALSDVTISTCHVSAKVGTRLVFDHYGKIIQKTPYP    281 - 350
HPRGMTVSVKQLFSTLPVHHKEFQRNIKKKRACFPFAFCRDCQFPEASPAMLPVQPAELTPRSTPPHPCS    351 - 420
LEDNVITVFSSVKNGPGSSR                                                      421 - 440
//

Text Mined References (8)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15077197 2004 Novel PMS2 pseudogenes can conceal recessive mutations causing a distinctive childhood cancer syndrome.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10101297 1999 The human PMS2L proteins do not interact with hMLH1, a major DNA mismatch repair protein.
8586419 1995 Genomic organization of the human PMS2 gene family.
7980603 1994 Cloning, characterization and chromosomal assignment of the human genes homologous to yeast PMS1, a member of mismatch repair genes.