Property Summary

NCBI Gene PubMed Count 7
PubMed Score 339.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
ovarian cancer 8520 0.0 5.0
Disease Target Count Z-score Confidence
Lynch syndrome 35 7.723 3.9

Synonym

Accession A4D2B8 Q0VGD2 Q13400 Q16530 Q6NVZ2 Q7KZ90
Symbols PMS3
PMS8
PMSR1
PMSR2
PMS2L1
PMS2L6
PMS2L7
PMS2L8
PMS2L13

Gene

 GO Component (1)

 GWAS Trait (1)

AA Sequence

MVTMCGGHRPENFLHQVLTEFGEELAGEGKSEVGGGAPRSYLQVASAECWAAAPAVHVGEPVHAGGLHTE      1 - 70
RGADPVIGLYLVHRGGACQTPTVGNRQTPTLGIHARPRRRATTSLLTLLLAFGKNAVRCALIGPGSLTSR     71 - 140
TRPLTEPLGEKERREVFFPPRPERVEHNVESSRWEPRRRGACGSRGGNFPSPRGGSGVASLERAESSSTE    141 - 210
PAKAIKPIDRKSVHQICSGPVVPSLSTAVKELVENSLDAGATNIDLKLKDYGVDLIEVSGNGCGVEEENF    211 - 280
EGLTLKHHTSKIQEFADLPQVETFGFRGEALSSLCALSDVTISTCHVSAKVGTRLVFDHYGKIIQKTPYP    281 - 350
HPRGMTVSVKQLFSTLPVHHKEFQRNIKKKRACFPFAFCRDCQFPEASPAMLPVQPAELTPRSTPPHPCS    351 - 420
LEDNVITVFSSVKNGPGSSR                                                      421 - 440
//

Text Mined References (8)

PMID Year Title