Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.05
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Synonym

Accession A4D256 Q2VIP7 Q6NUS3 Q8NCT2
Symbols CDC14B2
CDC14CP
CDC14Bretro

Gene

AA Sequence

MNEVSSECGKKCEPLGCSSTNGDLQGEAGAVVSIFLRMVPRIKSNEGYGYSNRNWRKENTMHSLDRNIVD      1 - 70
GGQALGQWKRKSKGRSSWAAAPHCSPRCSLTSQGVKKMRSSTLQDPRRRDPQDDVYVDITDRLRFAILYS     71 - 140
RPKSASNVHYFSIDNELEYENFSEDFGPLNLAMVYRYCCKINKKLKSITMLRKKIVHFTGSDQRKQANAA    141 - 210
FLVGCYMVIYLGRTPEAAYRILIFGDTPYIPFRDAAYGSCNFYITLLDCFHAVKKAMQYGFLNFNSFNLD    211 - 280
EYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGYHQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRF    281 - 350
TDAGFDHHDLFFADGSTPTDAIVKRFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAW    351 - 420
VRICRPGLVIGPQQQFLVMKQTSLWLEGDYFRQRLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEP    421 - 490
KPYSDDDEINGVTQGDRSRALKRRRQSKTNDILLPSPLAVLTFTLCSVVIWWIVCDYILPILLF          491 - 554
//

Publication (8)

PMID Year Title
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
20720150 2010 Cdc14: a highly conserved family of phosphatases with non-conserved functions?
18547142 2008 Birth and rapid subcellular adaptation of a hominoid-specific CDC14 protein.
16201836 2005 Emergence of young human genes after a burst of retroposition in primates.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.