Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Nasopharynx carcinoma 18 0.0 1.8

Gene RIF (1)

AA Sequence

MMKDIIPASSWASEESTDLQNGSFPLSVAPRSEFPRRRALEDWLLSVFLADQAESEGQLVLERVRDTPPP      1 - 70
VTSPRGDGICVSRGKAPSSPGGSTHAWLYLTRHFPWSPFPHGGWTDTSEPCVLETLGGSSLAALRGNSLW     71 - 140
VQSSGACAFCVYESLIEQSLPNERFEELLLGPSPGEVMK                                   141 - 179
//

Text Mined References (3)

PMID Year Title