Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Nasopharynx carcinoma 19 0.0 1.0

Gene RIF (1)

PMID Text
14667812 BLACE is located in region 7q36 and significant expression of BLACE was detected by RT-PCR in bone marrow samples from B cell acute lymphoblastic leukemia patients.

AA Sequence

MMKDIIPASSWASEESTDLQNGSFPLSVAPRSEFPRRRALEDWLLSVFLADQAESEGQLVLERVRDTPPP      1 - 70
VTSPRGDGICVSRGKAPSSPGGSTHAWLYLTRHFPWSPFPHGGWTDTSEPCVLETLGGSSLAALRGNSLW     71 - 140
VQSSGACAFCVYESLIEQSLPNERFEELLLGPSPGEVMK                                   141 - 179
//

Text Mined References (3)

PMID Year Title
14667812 2004 A gene expressed exclusively in acute B lymphoblastic leukemias.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.