Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Nasopharynx carcinoma 18 1.0

Synonym

Accession A4D250
Symbols

Gene

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
14667812 BLACE is located in region 7q36 and significant expression of BLACE was detected by RT-PCR in bone marrow samples from B cell acute lymphoblastic leukemia patients.

AA Sequence

MMKDIIPASSWASEESTDLQNGSFPLSVAPRSEFPRRRALEDWLLSVFLADQAESEGQLVLERVRDTPPP      1 - 70
VTSPRGDGICVSRGKAPSSPGGSTHAWLYLTRHFPWSPFPHGGWTDTSEPCVLETLGGSSLAALRGNSLW     71 - 140
VQSSGACAFCVYESLIEQSLPNERFEELLLGPSPGEVMK                                   141 - 179
//

Text Mined References (3)

PMID Year Title
14667812 2004 A gene expressed exclusively in acute B lymphoblastic leukemias.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.