Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 5.3e-17

Synonym

Accession A4D1Z8 A0A087WXP5
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

 GO Function (1)

 Compartment GO Term (0)

 GWAS Trait (1)

 HCA RNA Cell Line (3)

AA Sequence

MAVQSKAFCAGGLAPGWKLLVQGHADSGEDRFETNFLLETGDIAFHIKPRFSSATVVGNAFQYGRWGPEQ      1 - 70
VSSIFPLAPGEPFEIEVSWDAEHFHVYAPEHKVLQFPCRQRPLGATTRVRVLSDHCLAQVELAKRGLSWG     71 - 140
DRGY                                                                      141 - 144
//

Text Mined References (8)

PMID Year Title