Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,683

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.100 0.000

Synonym

Accession A4D1Z8 A0A087WXP5
Symbols

Gene

PANTHER Protein Class (1)

 GO Function (1)

 Compartment GO Term (0)

AA Sequence

MAVQSKAFCAGGLAPGWKLLVQGHADSGEDRFETNFLLETGDIAFHIKPRFSSATVVGNAFQYGRWGPEQ      1 - 70
VSSIFPLAPGEPFEIEVSWDAEHFHVYAPEHKVLQFPCRQRPLGATTRVRVLSDHCLAQVELAKRGLSWG     71 - 140
DRGY                                                                      141 - 144
//

Publication (8)

PMID Year Title
19296714 2009 Interactions between small heat shock protein alpha-crystallin and galectin-related interfiber protein (GRIFIN) in the ocular lens.
18448074 2008 Unlike mammalian GRIFIN, the zebrafish homologue (DrGRIFIN) represents a functional carbohydrate-binding galectin.
18087242 2007 A comparative gene expression profile of the whole eye from human, mouse, and guinea pig.
17999360 2007 Type 2 NF1 deletions are highly unusual by virtue of the absence of nonallelic homologous recombination hotspots and an apparent preference for female mitotic recombination.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
9786891 1998 GRIFIN, a novel lens-specific protein related to the galectin family.