Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.85
PubTator Score 0.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 6.3e-05
Disease Target Count Z-score Confidence
Bulimia nervosa 14 3.482 1.7
Male infertility 206 3.371 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 6.3e-05

Gene RIF (1)

AA Sequence

MKYVFYLGVLAGTFFFADSSVQKEDPAPYLVYLKSHFNPCVGVLIKPSWVLAPAHCYLPNLKVMLGNFKS      1 - 70
RVRDGTEQTINPIQIVRYWNYSHSAPQDDLMLIKLAKPAMLNPKVQPLTLATTNVRPGTVCLLSGLDWSQ     71 - 140
ENSGRHPDLRQNLEAPVMSDRECQKTEQGKSHRNSLCVKFVKVFSRIFGEVAVATVICKDKLQGIEVGHF    141 - 210
MGGDVGIYTNVYKYVSWIENTAKDK                                                 211 - 235
//

Text Mined References (6)

PMID Year Title