Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.85
PubTator Score 0.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 6.34673011965335E-5
Disease Target Count Z-score Confidence
Bulimia nervosa 15 3.467 1.7
Male infertility 170 3.377 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 0.000

Synonym

Accession A4D1T9 B2RPB5
Symbols TRYX2

Gene

  Ortholog (7)

AA Sequence

MKYVFYLGVLAGTFFFADSSVQKEDPAPYLVYLKSHFNPCVGVLIKPSWVLAPAHCYLPNLKVMLGNFKS      1 - 70
RVRDGTEQTINPIQIVRYWNYSHSAPQDDLMLIKLAKPAMLNPKVQPLTLATTNVRPGTVCLLSGLDWSQ     71 - 140
ENSGRHPDLRQNLEAPVMSDRECQKTEQGKSHRNSLCVKFVKVFSRIFGEVAVATVICKDKLQGIEVGHF    141 - 210
MGGDVGIYTNVYKYVSWIENTAKDK                                                 211 - 235
//

Text Mined References (5)

PMID Year Title
21630459 2011 Proteomic characterization of the human sperm nucleus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.