Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.31
PubTator Score 1.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
pilocytic astrocytoma 3086 3.57 1.8

Expression

Synonym

Accession A4D1S5 A4D1S6 B2RTS6 B5MDR2 Q9UL27
Symbols RAB19B

Gene

  Ortholog (11)

AA Sequence

MHFSSSARAADENFDYLFKIILIGDSNVGKTCVVQHFKSGVYTETQQNTIGVDFTVRSLDIDGKKVKMQV      1 - 70
WDTAGQERFRTITQSYYRSAHAAIIAYDLTRRSTFESIPHWIHEIEKYGAANVVIMLIGNKCDLWEKRHV     71 - 140
LFEDACTLAEKYGLLAVLETSAKESKNIEEVFVLMAKELIARNSLHLYGESALNGLPLDSSPVLMAQGPS    141 - 210
EKTHCTC                                                                   211 - 217
//

Text Mined References (5)

PMID Year Title
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.