Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.31
PubTator Score 1.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Pilocytic astrocytoma 56 3.465 1.7

Expression

AA Sequence

MHFSSSARAADENFDYLFKIILIGDSNVGKTCVVQHFKSGVYTETQQNTIGVDFTVRSLDIDGKKVKMQV      1 - 70
WDTAGQERFRTITQSYYRSAHAAIIAYDLTRRSTFESIPHWIHEIEKYGAANVVIMLIGNKCDLWEKRHV     71 - 140
LFEDACTLAEKYGLLAVLETSAKESKNIEEVFVLMAKELIARNSLHLYGESALNGLPLDSSPVLMAQGPS    141 - 210
EKTHCTC                                                                   211 - 217
//

Text Mined References (5)

PMID Year Title