Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.66
PubTator Score 0.74

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.600 0.008
osteosarcoma -1.306 0.000
chronic lymphosyte leukemia 1.100 0.000
nasopharyngeal carcinoma 1.100 0.013

Gene RIF (1)

PMID Text
19460752 Knockdown of WD repeat domain 91 (WDR91; HSPC049) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MAEAVERTDELVREYLLFRGFTHTLRQLDAEIKADKEKGFRVDKIVDQLQQLMQVYDLAALRDYWSYLER      1 - 70
RLFSRLEDIYRPTIHKLKTSLFRFYLVYTIQTNRNDKAQEFFAKQATELQNQAEWKDWFVLPFLPSPDTN     71 - 140
PTFATYFSRQWADTFIVSLHNFLSVLFQCMPVPVILNFDAECQRTNQVQEENEVLRQKLFALQAEIHRLK    141 - 210
KEEQQPEEEEALVQHKLPPYVSNMDRLGDSELAMVCSQRNASLSQSPRVGFLSSLLPQSKKSPSRLSPAQ    211 - 280
GPPQPQSSAKKESFGGQGTKGKDPTSGAKDGKSLLSGLATGESGWSQHRQRRLQDHGKERKELFSTTTSQ    281 - 350
CAEKKPEASGPEAEPCPELHTEPVEPLTRASSAGPEGGGVRPEQPFIVLGQEEYGEHHSSIMHCRVDCSG    351 - 420
RRVASLDVDGVIKVWSFNPIMQTKASSISKSPLLSLEWATKRDRLLLLGSGVGTVRLYDTEAKKNLCEIN    421 - 490
INDNMPRILSLACSPNGASFVCSAAAPSLTSQVDFSAPDIGSKGMNQVPGRLLLWDTKTMKQQLQFSLDP    491 - 560
EPIAINCTAFNHNGNLLVTGAADGVIRLFDMQQHECAMSWRAHYGEVYSVEFSYDENTVYSIGEDGKFIQ    561 - 630
WNIHKSGLKVSEYSLPSDATGPFVLSGYSGYKQVQVPRGRLFAFDSEGNYMLTCSATGGVIYKLGGDEKV    631 - 700
LESCLSLGGHRAPVVTVDWSTAMDCGTCLTASMDGKIKLTTLLAHKA                           701 - 747
//

Publication (15)

PMID Year Title
26783301 2016 Negative regulation of phosphatidylinositol 3-phosphate levels in early-to-late endosome conversion.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
More...