Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.46
PubTator Score 0.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
chronic lymphosyte leukemia 204 5.4e-10
osteosarcoma 7950 2.1e-04
ependymoma 4679 8.3e-03
nasopharyngeal carcinoma 1058 1.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Usher syndrome type 1 10 5.387 2.7

Expression

  Differential Expression (4)

Disease log2 FC p
chronic lymphosyte leukemia 1.100 5.4e-10
ependymoma 1.600 8.3e-03
nasopharyngeal carcinoma 1.100 1.3e-02
osteosarcoma -1.306 2.1e-04

Gene RIF (3)

AA Sequence

MAEAVERTDELVREYLLFRGFTHTLRQLDAEIKADKEKGFRVDKIVDQLQQLMQVYDLAALRDYWSYLER      1 - 70
RLFSRLEDIYRPTIHKLKTSLFRFYLVYTIQTNRNDKAQEFFAKQATELQNQAEWKDWFVLPFLPSPDTN     71 - 140
PTFATYFSRQWADTFIVSLHNFLSVLFQCMPVPVILNFDAECQRTNQVQEENEVLRQKLFALQAEIHRLK    141 - 210
KEEQQPEEEEALVQHKLPPYVSNMDRLGDSELAMVCSQRNASLSQSPRVGFLSSLLPQSKKSPSRLSPAQ    211 - 280
GPPQPQSSAKKESFGGQGTKGKDPTSGAKDGKSLLSGLATGESGWSQHRQRRLQDHGKERKELFSTTTSQ    281 - 350
CAEKKPEASGPEAEPCPELHTEPVEPLTRASSAGPEGGGVRPEQPFIVLGQEEYGEHHSSIMHCRVDCSG    351 - 420
RRVASLDVDGVIKVWSFNPIMQTKASSISKSPLLSLEWATKRDRLLLLGSGVGTVRLYDTEAKKNLCEIN    421 - 490
INDNMPRILSLACSPNGASFVCSAAAPSLTSQVDFSAPDIGSKGMNQVPGRLLLWDTKTMKQQLQFSLDP    491 - 560
EPIAINCTAFNHNGNLLVTGAADGVIRLFDMQQHECAMSWRAHYGEVYSVEFSYDENTVYSIGEDGKFIQ    561 - 630
WNIHKSGLKVSEYSLPSDATGPFVLSGYSGYKQVQVPRGRLFAFDSEGNYMLTCSATGGVIYKLGGDEKV    631 - 700
LESCLSLGGHRAPVVTVDWSTAMDCGTCLTASMDGKIKLTTLLAHKA                           701 - 747
//

Text Mined References (18)

PMID Year Title