Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.66
PubTator Score 0.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
chronic lymphosyte leukemia 232 5.41604753320878E-10
osteosarcoma 7933 2.14029611954942E-4
ependymoma 2514 0.00829222700917963
nasopharyngeal carcinoma 1056 0.013493924295662

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.600 0.008
osteosarcoma -1.306 0.000
chronic lymphosyte leukemia 1.100 0.000
nasopharyngeal carcinoma 1.100 0.013

Synonym

Accession A4D1P6 A6NK54 C9JMI4 Q6FI65 Q6MZQ1 Q6P4I1 Q96AE5 Q96G63 Q9H062 Q9H9B6 Q9NVG7 Q9NZY6
Symbols SORF1
SORF-1
HSPC049

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 Compartment GO Term (2)

Gene RIF (1)

PMID Text
19460752 Knockdown of WD repeat domain 91 (WDR91; HSPC049) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MAEAVERTDELVREYLLFRGFTHTLRQLDAEIKADKEKGFRVDKIVDQLQQLMQVYDLAALRDYWSYLER      1 - 70
RLFSRLEDIYRPTIHKLKTSLFRFYLVYTIQTNRNDKAQEFFAKQATELQNQAEWKDWFVLPFLPSPDTN     71 - 140
PTFATYFSRQWADTFIVSLHNFLSVLFQCMPVPVILNFDAECQRTNQVQEENEVLRQKLFALQAEIHRLK    141 - 210
KEEQQPEEEEALVQHKLPPYVSNMDRLGDSELAMVCSQRNASLSQSPRVGFLSSLLPQSKKSPSRLSPAQ    211 - 280
GPPQPQSSAKKESFGGQGTKGKDPTSGAKDGKSLLSGLATGESGWSQHRQRRLQDHGKERKELFSTTTSQ    281 - 350
CAEKKPEASGPEAEPCPELHTEPVEPLTRASSAGPEGGGVRPEQPFIVLGQEEYGEHHSSIMHCRVDCSG    351 - 420
RRVASLDVDGVIKVWSFNPIMQTKASSISKSPLLSLEWATKRDRLLLLGSGVGTVRLYDTEAKKNLCEIN    421 - 490
INDNMPRILSLACSPNGASFVCSAAAPSLTSQVDFSAPDIGSKGMNQVPGRLLLWDTKTMKQQLQFSLDP    491 - 560
EPIAINCTAFNHNGNLLVTGAADGVIRLFDMQQHECAMSWRAHYGEVYSVEFSYDENTVYSIGEDGKFIQ    561 - 630
WNIHKSGLKVSEYSLPSDATGPFVLSGYSGYKQVQVPRGRLFAFDSEGNYMLTCSATGGVIYKLGGDEKV    631 - 700
LESCLSLGGHRAPVVTVDWSTAMDCGTCLTASMDGKIKLTTLLAHKA                           701 - 747
//

Text Mined References (15)

PMID Year Title
26783301 2016 Negative regulation of phosphatidylinositol 3-phosphate levels in early-to-late endosome conversion.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
More...