Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.73
PubTator Score 1.00

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 1.76481037202214E-7
medulloblastoma, large-cell 6234 7.66030522508224E-5
group 3 medulloblastoma 2254 3.12201904578443E-4
ovarian cancer 8492 3.99144400603515E-4


  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.815 0.000
group 3 medulloblastoma 1.300 0.000
medulloblastoma, large-cell 1.200 0.000
ovarian cancer 1.400 0.000


Accession A4D1E9 B4DFY6 Q3B7A6 Q5H9V2 Q8IXG8 Q8N982 Q8WU16 Q9BSP1 Q9Y6T6
Symbols ObgH2


  Ortholog (12)

Species Source
Macaque EggNOG Inparanoid
Mouse EggNOG Inparanoid
Rat EggNOG Inparanoid
Dog EggNOG Inparanoid
Cow EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus EggNOG Inparanoid
Chicken EggNOG Inparanoid
Anole lizard EggNOG Inparanoid
Xenopus EggNOG Inparanoid
C. elegans EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (1)

17054726 Knock-down of ObgH1 by RNAi induced mitochondria elongation, whereas knock-down of ObgH2 resulted in the disorganization of the nucleolar architecture.

AA Sequence

NDALHKKQLLNLWISDTMSSTEPPSKHAVTTSKMDII                                     351 - 387

Text Mined References (14)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
23824729 2013 Common genetic loci influencing plasma homocysteine concentrations and their effect on risk of coronary artery disease.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
17054726 2006 Human small G proteins, ObgH1, and ObgH2, participate in the maintenance of mitochondria and nucleolar architectures.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).