Property Summary

NCBI Gene PubMed Count 10
PubMed Score 17.38
PubTator Score 20.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 8.63948816928921E-19
malignant mesothelioma 3163 9.46832256513929E-10
ovarian cancer 8492 4.71734149389887E-8
cystic fibrosis 1670 1.15155134029882E-6
lung cancer 4473 2.61681791772555E-6
atypical teratoid / rhabdoid tumor 4369 5.97404428201296E-6
Pick disease 1893 8.20551173704E-6
ulcerative colitis 2087 1.78609624903894E-5
psoriasis 6685 3.05252962200046E-5
medulloblastoma 1524 1.09692690728034E-4
glioblastoma 5572 4.81272366797603E-4
medulloblastoma, large-cell 6234 5.60826365041433E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00154635851538255
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00383884128262894
invasive ductal carcinoma 2950 0.00481229219841455
Breast cancer 3099 0.00494729896311396
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00676682412000968
subependymal giant cell astrocytoma 2287 0.00810933905498821
Waldenstrons macroglobulinemia 765 0.00939647761790126
progressive supranuclear palsy 674 0.0193738644329877
osteosarcoma 7933 0.0309224151540735
Disease Target Count Z-score Confidence
Alzheimer's disease 644 3.482 1.7
Echinococcosis 28 3.292 1.6

Expression

Synonym

Accession A4D1B5 A4D1B6 Q3MJC0 Q8ND73 Q9UMH3 Q9Y4L9 GSAP
Symbols PION

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Fruitfly OMA Inparanoid

Gene RIF (6)

PMID Text
26076991 GSAP cleavage via caspase-3 is regulated and depend upon the availability of 5-Lipoxygenase in Alzheimer's disease.
25037285 Its promoter variant contributes to Alzheimer's disease liability.
23209290 gamma-secretase activating protein (GSAP) and imatinib have roles in the regulation of gamma-secretase activity and amyloid-beta generation
22681044 Protocols for recombinant bacterial expression and purification of potentially important protein GSAP are not successful in generating soluble forms of GSAP that contain well-ordered and homogeneous tertiary structure.
21718343 Aberrant regulation of gamma-secretase activating protein expression plays a key role in acceleration of gamma-cleavage of beta-secretase-cleaved C-terminal fragment of amyloid precursor protein and accumulation of Abeta in AD brains
20811458 A gamma-secretase activating protein (GSAP) that selectively increases amyloid-beta production via interactions with both gamma-secretase and its substrate, the amyloid precursor protein carboxy-terminal fragment.

AA Sequence

MALRLVADFDLGKDVLPWLRAQRAVSEASGAGSGGADVLENDYESLHVLNVERNGNIIYTYKDDKGNVVF      1 - 70
GLYDCQTRQNELLYTFEKDLQVFSCSVNSERTLLAASLVQSTKEGKRNELQPGSKCLTLLVEIHPVNNVK     71 - 140
VLKAVDSYIWVQFLYPHIESHPLPENHLLLISEEKYIEQFRIHVAQEDGNRVVIKNSGHLPRDRIAEDFV    141 - 210
WAQWDMSEQRLYYIDLKKSRSILKCIQFYADESYNLMFEVPLDISLSNSGFKLVNFGCDYHQYRDKFSKH    211 - 280
LTLCVFTNHTGSLCVCYSPKCASWGQITYSVFYIHKGHSKTFTTSLENVGSHMTKGITFLNLDYYVAVYL    281 - 350
PGHFFHLLNVQHPDLICHNLFLTGNNEMIDMLPHCPLQSLSGSLVLDCCSGKLYRALLSQSSLLQLLQNT    351 - 420
CLDCEKMAALHCALYCGQGAQFLEAQIIQWISENVSACHSFDLIQEFIIASSYWSVYSETSNMDKLLPHS    421 - 490
SVLTWNTEIPGITLVTEDIALPLMKVLSFKGYWEKLNSNLEYVKYAKPHFHYNNSVVRREWHNLISEEKT    491 - 560
GKRRSAAYVRNILDNAVKVISNLEARNLGPRLTPLLQEEDSHQRLLMGLMVSELKDHFLRHLQGVEKKKI    561 - 630
EQMVLDYISKLLDLICHIVETNWRKHNLHSWVLHFNSRGSAAEFAVFHIMTRILEATNSLFLPLPPGFHT    631 - 700
LHTILGVQCLPLHNLLHCIDSGVLLLTETAVIRLMKDLDNTEKNEKLKFSIIVRLPPLIGQKICRLWDHP    701 - 770
MSSNIISRNHVTRLLQNYKKQPRNSMINKSSFSVEFLPLNYFIEILTDIESSNQALYPFEGHDNVDAEFV    771 - 840
EEAALKHTAMLLGL                                                            841 - 854
//

Text Mined References (13)

PMID Year Title
26076991 2015 Regulation of gamma-secretase activating protein by the 5Lipoxygenase: in vitro and in vivo evidence.
25037285 2014 Common GSAP promoter variant contributes to Alzheimer's disease liability.
23209290 2013 The role of ?-secretase activating protein (GSAP) and imatinib in the regulation of ?-secretase activity and amyloid-? generation.
22681044 2012 Purification and characterization of the human ?-secretase activating protein.
21718343 2012 Immunohistochemical characterization of ?-secretase activating protein expression in Alzheimer's disease brains.
20811458 2010 Gamma-secretase activating protein is a therapeutic target for Alzheimer's disease.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...