Property Summary

Ligand Count 2
NCBI Gene PubMed Count 10
PubMed Score 16.79
PubTator Score 20.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -2.400 1.2e-05
Breast cancer 1.200 4.9e-03
cystic fibrosis 2.234 1.2e-06
glioblastoma 2.000 4.8e-04
group 4 medulloblastoma -1.700 9.7e-04
intraductal papillary-mucinous adenoma (... 1.500 3.3e-03
intraductal papillary-mucinous carcinoma... 1.400 1.4e-02
intraductal papillary-mucinous neoplasm ... 2.000 5.2e-03
invasive ductal carcinoma 1.236 4.8e-03
lung cancer -2.300 6.3e-04
malignant mesothelioma -5.100 9.4e-08
medulloblastoma, large-cell -2.400 5.6e-04
non-small cell lung cancer -2.135 6.4e-18
osteosarcoma -1.285 4.4e-02
ovarian cancer -3.000 4.7e-08
Pick disease -1.800 8.2e-06
progressive supranuclear palsy -1.500 1.9e-02
psoriasis -1.200 3.1e-05
subependymal giant cell astrocytoma 2.440 7.9e-03
ulcerative colitis 1.800 2.2e-05
Waldenstrons macroglobulinemia 1.223 1.1e-02

Gene RIF (6)

AA Sequence

MALRLVADFDLGKDVLPWLRAQRAVSEASGAGSGGADVLENDYESLHVLNVERNGNIIYTYKDDKGNVVF      1 - 70
GLYDCQTRQNELLYTFEKDLQVFSCSVNSERTLLAASLVQSTKEGKRNELQPGSKCLTLLVEIHPVNNVK     71 - 140
VLKAVDSYIWVQFLYPHIESHPLPENHLLLISEEKYIEQFRIHVAQEDGNRVVIKNSGHLPRDRIAEDFV    141 - 210
WAQWDMSEQRLYYIDLKKSRSILKCIQFYADESYNLMFEVPLDISLSNSGFKLVNFGCDYHQYRDKFSKH    211 - 280
LTLCVFTNHTGSLCVCYSPKCASWGQITYSVFYIHKGHSKTFTTSLENVGSHMTKGITFLNLDYYVAVYL    281 - 350
PGHFFHLLNVQHPDLICHNLFLTGNNEMIDMLPHCPLQSLSGSLVLDCCSGKLYRALLSQSSLLQLLQNT    351 - 420
CLDCEKMAALHCALYCGQGAQFLEAQIIQWISENVSACHSFDLIQEFIIASSYWSVYSETSNMDKLLPHS    421 - 490
SVLTWNTEIPGITLVTEDIALPLMKVLSFKGYWEKLNSNLEYVKYAKPHFHYNNSVVRREWHNLISEEKT    491 - 560
GKRRSAAYVRNILDNAVKVISNLEARNLGPRLTPLLQEEDSHQRLLMGLMVSELKDHFLRHLQGVEKKKI    561 - 630
EQMVLDYISKLLDLICHIVETNWRKHNLHSWVLHFNSRGSAAEFAVFHIMTRILEATNSLFLPLPPGFHT    631 - 700
LHTILGVQCLPLHNLLHCIDSGVLLLTETAVIRLMKDLDNTEKNEKLKFSIIVRLPPLIGQKICRLWDHP    701 - 770
MSSNIISRNHVTRLLQNYKKQPRNSMINKSSFSVEFLPLNYFIEILTDIESSNQALYPFEGHDNVDAEFV    771 - 840
EEAALKHTAMLLGL                                                            841 - 854
//

Text Mined References (13)

PMID Year Title