Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A4D174
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MGSCGWALTQSDWCPFKKRKRHQRCAHSETRHMRTQRQGGYLQARERGLGEANPAYALILDFQPPELQNL      1 - 70
SEMGINHELGYSSIIPMMKRAFSACGTLGLIMSGIFDNPGPIKNTLKKAFTMLWSFTVYTRLESLRVALS     71 - 140
NEEMVPFIFHLKTQTANMLSGPISTPMLL                                             141 - 169
//

Text Mined References (6)

PMID Year Title
24684796 2014 Heritability and genetic association analysis of cognition in the Diabetes Heart Study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.