Property Summary

NCBI Gene PubMed Count 19
Grant Count 1
Funding $57,995
PubMed Score 4.04
PubTator Score 8.48

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
24945404 Variants at the CPED1 locus were strongly associated with bone mineral density at the skull and upper limb sites, but not with lower limb-bone mineral density.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20031566 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVCRPVFPCRRRFCPRPFLVGLVVAICLFYQTLTLRGSRKLTAAAPGAVPHTSTETQASRCKKGFSQDKQ      1 - 70
CFLLSGNAQETRKVKESMETHFGSHGRRAILYRPPFYSKTELQLHQHILTQHGYTVVIAEERLNAGLGPG     71 - 140
LLEQGDLGSWDLLICLSSKKAEGTPCISKEVMCQLGLHQKANRLPEIQQPLCRKEGLCQIVRRFPELQLP    141 - 210
VSPSVCLDQGMQLKPSTSSHLLKTVKPRVWKPGDWSREQLNETTVLAPHETIFRAEDLSVILKAYVLVTS    211 - 280
LTPLRAFIHSTGTVWNPPKKKRFTVKLQTFFETFLRASSPQQAFDIMKEAIGKLLLAAEVFSETSTLGPK    281 - 350
TFHRCRFCFQLLTFDIGYGSFMYPVVLQVHEHLNFQDYDNMDFEDQNTEEFLLNDTFNFLFPNESSLSIF    351 - 420
SEIFQRLYRSDVFKGENYQKELNQCLSLEEINSIMTFIKELGSLGQFQLLFPSTTPGIQSLMHEFYDVAN    421 - 490
PVGNPGSVLTQYWSLLNVFEQFQFMNKKTQPHPLEWNSFTEDKNIEKPQVPFDAIENKKAAVPQIKNENK    491 - 560
EIHCSDDENTPCHIKQIFTHPHLELNPDFHPKIKDYYCEVPFDVVTVTIGVETPKCLCKVHLYEQAGPSF    561 - 630
ASYPLGLGMNKISIFVVDESPAHGETLITYKLTIYREDRPSLPLFEAFTACGFVQDCGLLIHPEETCGLQ    631 - 700
PISSDYIEAILQSELKRCPSGDMKGQWIVPCLSCSDNRTCDWREITWQPHNCQYGVLTKPQLQQCLGGRK    701 - 770
ILFIGDSTNRGIMYYLIERLNETLQEWQKVHGTKFYHNVNGGKTLISYSYYPQFWISPSLRPTFENALEH    771 - 840
LLQRSRPLENTGQTVLVVGGVQWLNSNHLQIIHKVLKRENLLNILVIIKTLGIGFHLPVDGVHFLTQSEV    841 - 910
QNLWKENLIILDTAKKHGYEVVDTFTITMGRYKEFLQGKCGCHFHEVVKSKLSKEYNFIKMKRSRNHIMG    911 - 980
RYFSNQSKLQQGTVTNFRSPYHVRGPINQVCSEILLSRMCANKRTM                            981 - 1026
//

Text Mined References (22)

PMID Year Title
24945404 2014 Phenotypic dissection of bone mineral density reveals skeletal site specificity and facilitates the identification of novel loci in the genetic regulation of bone mass attainment.
22792070 2012 Meta-analysis of genome-wide scans for total body BMD in children and adults reveals allelic heterogeneity and age-specific effects at the WNT16 locus.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20082467 2010 A complex chromosome 7q rearrangement identified in a patient with mental retardation, anxiety disorder, and autistic features.
20056006 2010 Novel eukaryotic enzymes modifying cell-surface biopolymers.
20031566 2009 Association of regions on chromosomes 6 and 7 with blood pressure in Nigerian families.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
16341674 2005 Transcriptome analysis of human gastric cancer.
More...