Property Summary

NCBI Gene PubMed Count 19
PubMed Score 4.99
PubTator Score 8.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (26)

Disease log2 FC p
acute myeloid leukemia -1.300 1.2e-02
adult high grade glioma 1.100 5.9e-05
Astrocytoma, Pilocytic 2.100 2.1e-07
Atopic dermatitis -1.900 6.8e-04
breast carcinoma -1.400 3.9e-17
colon cancer -1.400 1.4e-02
cystic fibrosis 1.110 5.3e-03
ductal carcinoma in situ -2.500 7.3e-05
fibroadenoma -1.400 3.1e-02
glioblastoma 1.200 2.3e-03
head and neck cancer -1.700 3.0e-02
intraductal papillary-mucinous adenoma (... -1.400 7.9e-03
intraductal papillary-mucinous carcinoma... -2.800 2.8e-03
intraductal papillary-mucinous neoplasm ... -2.700 2.1e-03
invasive ductal carcinoma -2.900 6.6e-04
lung adenocarcinoma -1.400 7.3e-13
lung carcinoma -2.400 9.0e-24
malignant mesothelioma -1.700 5.6e-06
non-small cell lung cancer -2.054 5.5e-20
osteosarcoma 1.373 1.8e-02
ovarian cancer -2.500 4.2e-10
pancreatic cancer 1.600 3.1e-03
pancreatic ductal adenocarcinoma liver m... -1.513 6.1e-03
pituitary cancer -1.100 1.3e-03
sonic hedgehog group medulloblastoma 1.200 4.8e-03
tuberculosis 1.100 9.6e-06

Gene RIF (3)

AA Sequence

MVCRPVFPCRRRFCPRPFLVGLVVAICLFYQTLTLRGSRKLTAAAPGAVPHTSTETQASRCKKGFSQDKQ      1 - 70
CFLLSGNAQETRKVKESMETHFGSHGRRAILYRPPFYSKTELQLHQHILTQHGYTVVIAEERLNAGLGPG     71 - 140
LLEQGDLGSWDLLICLSSKKAEGTPCISKEVMCQLGLHQKANRLPEIQQPLCRKEGLCQIVRRFPELQLP    141 - 210
VSPSVCLDQGMQLKPSTSSHLLKTVKPRVWKPGDWSREQLNETTVLAPHETIFRAEDLSVILKAYVLVTS    211 - 280
LTPLRAFIHSTGTVWNPPKKKRFTVKLQTFFETFLRASSPQQAFDIMKEAIGKLLLAAEVFSETSTLGPK    281 - 350
TFHRCRFCFQLLTFDIGYGSFMYPVVLQVHEHLNFQDYDNMDFEDQNTEEFLLNDTFNFLFPNESSLSIF    351 - 420
SEIFQRLYRSDVFKGENYQKELNQCLSLEEINSIMTFIKELGSLGQFQLLFPSTTPGIQSLMHEFYDVAN    421 - 490
PVGNPGSVLTQYWSLLNVFEQFQFMNKKTQPHPLEWNSFTEDKNIEKPQVPFDAIENKKAAVPQIKNENK    491 - 560
EIHCSDDENTPCHIKQIFTHPHLELNPDFHPKIKDYYCEVPFDVVTVTIGVETPKCLCKVHLYEQAGPSF    561 - 630
ASYPLGLGMNKISIFVVDESPAHGETLITYKLTIYREDRPSLPLFEAFTACGFVQDCGLLIHPEETCGLQ    631 - 700
PISSDYIEAILQSELKRCPSGDMKGQWIVPCLSCSDNRTCDWREITWQPHNCQYGVLTKPQLQQCLGGRK    701 - 770
ILFIGDSTNRGIMYYLIERLNETLQEWQKVHGTKFYHNVNGGKTLISYSYYPQFWISPSLRPTFENALEH    771 - 840
LLQRSRPLENTGQTVLVVGGVQWLNSNHLQIIHKVLKRENLLNILVIIKTLGIGFHLPVDGVHFLTQSEV    841 - 910
QNLWKENLIILDTAKKHGYEVVDTFTITMGRYKEFLQGKCGCHFHEVVKSKLSKEYNFIKMKRSRNHIMG    911 - 980
RYFSNQSKLQQGTVTNFRSPYHVRGPINQVCSEILLSRMCANKRTM                            981 - 1026
//

Text Mined References (22)

PMID Year Title