Property Summary

NCBI Gene PubMed Count 19
PubMed Score 4.04
PubTator Score 8.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count
Creutzfeldt-Jakob disease 19
Disease Target Count P-value
lung carcinoma 2844 9.02803588379337E-24
non-small cell lung cancer 2798 5.46761216681938E-20
lung adenocarcinoma 2714 6.77950968508147E-18
breast carcinoma 1614 3.90880898421091E-17
ovarian cancer 8492 4.20962241660616E-10
pilocytic astrocytoma 3086 1.43058696663032E-7
cystic fibrosis 1670 4.60775689681673E-7
malignant mesothelioma 3163 5.56214433510029E-6
tuberculosis 1563 6.3898926638303E-6
ductal carcinoma in situ 1745 7.27981152609021E-5
adult high grade glioma 2148 1.17040603844098E-4
invasive ductal carcinoma 2950 6.55347689222502E-4
Atopic dermatitis 944 6.84984332357635E-4
pituitary cancer 1972 0.00129915064878893
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00206189450437268
glioblastoma 5572 0.00230467012961305
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00283520791501633
pancreatic cancer 2300 0.00313960517957784
sonic hedgehog group medulloblastoma 1482 0.004769296720787
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0060975230171867
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00792241563445949
acute myeloid leukemia 785 0.0123903305995848
colon cancer 1475 0.0136177693932737
osteosarcoma 7933 0.0183835279657766
head and neck cancer 270 0.030043707194001
fibroadenoma 557 0.0312003318426759
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Osteoporosis 259 0.0 2.0
Disease Target Count Z-score Confidence
Coffin-Siris syndrome 17 4.155 2.1
Werner syndrome 29 3.797 1.9

Expression

Synonym

Accession A4D0V7 A8K1R3 Q6UXT1 Q86T76 Q86T84 Q8N2T5 Q96NC9
Symbols C7orf58

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Pathway (1)

Gene RIF (3)

PMID Text
24945404 Variants at the CPED1 locus were strongly associated with bone mineral density at the skull and upper limb sites, but not with lower limb-bone mineral density.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20031566 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVCRPVFPCRRRFCPRPFLVGLVVAICLFYQTLTLRGSRKLTAAAPGAVPHTSTETQASRCKKGFSQDKQ      1 - 70
CFLLSGNAQETRKVKESMETHFGSHGRRAILYRPPFYSKTELQLHQHILTQHGYTVVIAEERLNAGLGPG     71 - 140
LLEQGDLGSWDLLICLSSKKAEGTPCISKEVMCQLGLHQKANRLPEIQQPLCRKEGLCQIVRRFPELQLP    141 - 210
VSPSVCLDQGMQLKPSTSSHLLKTVKPRVWKPGDWSREQLNETTVLAPHETIFRAEDLSVILKAYVLVTS    211 - 280
LTPLRAFIHSTGTVWNPPKKKRFTVKLQTFFETFLRASSPQQAFDIMKEAIGKLLLAAEVFSETSTLGPK    281 - 350
TFHRCRFCFQLLTFDIGYGSFMYPVVLQVHEHLNFQDYDNMDFEDQNTEEFLLNDTFNFLFPNESSLSIF    351 - 420
SEIFQRLYRSDVFKGENYQKELNQCLSLEEINSIMTFIKELGSLGQFQLLFPSTTPGIQSLMHEFYDVAN    421 - 490
PVGNPGSVLTQYWSLLNVFEQFQFMNKKTQPHPLEWNSFTEDKNIEKPQVPFDAIENKKAAVPQIKNENK    491 - 560
EIHCSDDENTPCHIKQIFTHPHLELNPDFHPKIKDYYCEVPFDVVTVTIGVETPKCLCKVHLYEQAGPSF    561 - 630
ASYPLGLGMNKISIFVVDESPAHGETLITYKLTIYREDRPSLPLFEAFTACGFVQDCGLLIHPEETCGLQ    631 - 700
PISSDYIEAILQSELKRCPSGDMKGQWIVPCLSCSDNRTCDWREITWQPHNCQYGVLTKPQLQQCLGGRK    701 - 770
ILFIGDSTNRGIMYYLIERLNETLQEWQKVHGTKFYHNVNGGKTLISYSYYPQFWISPSLRPTFENALEH    771 - 840
LLQRSRPLENTGQTVLVVGGVQWLNSNHLQIIHKVLKRENLLNILVIIKTLGIGFHLPVDGVHFLTQSEV    841 - 910
QNLWKENLIILDTAKKHGYEVVDTFTITMGRYKEFLQGKCGCHFHEVVKSKLSKEYNFIKMKRSRNHIMG    911 - 980
RYFSNQSKLQQGTVTNFRSPYHVRGPINQVCSEILLSRMCANKRTM                            981 - 1026
//

Text Mined References (22)

PMID Year Title
24945404 2014 Phenotypic dissection of bone mineral density reveals skeletal site specificity and facilitates the identification of novel loci in the genetic regulation of bone mass attainment.
22792070 2012 Meta-analysis of genome-wide scans for total body BMD in children and adults reveals allelic heterogeneity and age-specific effects at the WNT16 locus.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20082467 2010 A complex chromosome 7q rearrangement identified in a patient with mental retardation, anxiety disorder, and autistic features.
20056006 2010 Novel eukaryotic enzymes modifying cell-surface biopolymers.
20031566 2009 Association of regions on chromosomes 6 and 7 with blood pressure in Nigerian families.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
16341674 2005 Transcriptome analysis of human gastric cancer.
More...