Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma 1.600 1.4e-06
Breast cancer 2.600 2.5e-02
glioblastoma 1.200 1.5e-08
subependymal giant cell astrocytoma 1.962 2.8e-02

AA Sequence

MTSVSTQLSLVLMSLLLVLPVVEAVEAGDAIALLLGVVLSITGICACLGVYARKRNGQM                 1 - 59
//

Text Mined References (6)

PMID Year Title