Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
substance-related disorder 105 2.0

AA Sequence

MMAVMTPSDGLSQLSVPHLTHQRLWSLSCLAMLFQAVLILSAPQMSCLLKCFYALDPLHPVMSEEFSAQY      1 - 70
RHMMDQRYRTRIHEGYISQVKGAYLRIVHKKPISYAKSFPKEMGN                              71 - 115
//

Text Mined References (5)

PMID Year Title
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
22006218 2012 Large-scale genome-wide association study of Asian population reveals genetic factors in FRMD4A and other loci influencing smoking initiation and nicotine dependence.
12690205 2003 Human chromosome 7: DNA sequence and biology.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
9887257 1999 Analysis of heavy and light chain pairings indicates that receptor editing shapes the human antibody repertoire.