Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
substance-related disorder 162 0.0 2.2

AA Sequence

MMAVMTPSDGLSQLSVPHLTHQRLWSLSCLAMLFQAVLILSAPQMSCLLKCFYALDPLHPVMSEEFSAQY      1 - 70
RHMMDQRYRTRIHEGYISQVKGAYLRIVHKKPISYAKSFPKEMGN                              71 - 115
//

Text Mined References (5)

PMID Year Title