Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.63
PubTator Score 284.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.700 9.5e-06
astrocytic glioma -1.500 2.3e-02
Astrocytoma, Pilocytic -1.500 4.0e-06
atypical teratoid / rhabdoid tumor -1.300 1.4e-03
ependymoma -1.500 8.8e-08
glioblastoma -1.300 4.5e-04
intraductal papillary-mucinous adenoma (... 1.300 2.0e-03
intraductal papillary-mucinous carcinoma... 1.200 1.2e-03
lung cancer 2.200 1.1e-04
medulloblastoma -1.100 7.8e-03
medulloblastoma, large-cell -1.200 1.1e-03
oligodendroglioma -1.400 3.2e-02
osteosarcoma -1.389 2.7e-04
ovarian cancer 1.100 8.6e-04
Rheumatoid arthritis 1.200 2.1e-02
subependymal giant cell astrocytoma -1.561 1.4e-02

Protein-protein Interaction (1)

Gene RIF (2)

AA Sequence

MVEPGQDLLLAALSESGISPNDLFDIDGGDAGLATPMPTPSVQQSVPLSALELGLETEAAVPVKQEPETV      1 - 70
PTPALLNVRQQPPSTTTFVLNQINHLPPLGSTIVMTKTPPVTTNRQTITLTKFIQTTASTRPSVSAPTVR     71 - 140
NAMTSAPSKDQVQLKDLLKNNSLNELMKLKPPANIAQPVATAATDVSNGTVKKESSNKEGARMWINDMKM    141 - 210
RSFSPTMKVPVVKEDDEPEEEDEEEMGHAETYAEYMPIKLKIGLRHPDAVVETSSLSSVTPPDVWYKTSI    211 - 280
SEETIDNGWLSALQLEAITYAAQQHETFLPNGDRAGFLIGDGAGVGKGRTIAGIIYENYLLSRKRALWFS    281 - 350
VSNDLKYDAERDLRDIGAKNILVHSLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQSGGKYKTRLKQ    351 - 420
LLHWCGDDFDGVIVFDECHKAKNLCPVGSSKPTKTGLAVLELQNKLPKARVVYASATGASEPRNMAYMNR    421 - 490
LGIWGEGTPFREFSDFIQAVERRGVGAMEIVAMDMKLRGMYIARQLSFTGVTFKIEEVLLSQSYVKMYNK    491 - 560
AVKLWVIARERFQQAADLIDAEQRMKKSMWGQFWSAHQRFFKYLCIASKVKRVVQLAREEIKNGKCVVIG    561 - 630
LQSTGEARTLEALEEGGGELNDFVSTAKGVLQSLIEKHFPAPDRKKLYSLLGIDLTAPSNNSSPRDSPCK    631 - 700
ENKIKKRKGEEITREAKKARKVGGLTGSSSDDSGSESDASDNEESDYESSKNMSSGDDDDFNPFLDESNE    701 - 770
DDENDPWLIRKDHKKNKEKKKKKSIDPDSIQSALLASGLGSKRPSFSSTPVISPAPNSTPANSNTNSNSS    771 - 840
LITSQDAVERAQQMKKDLLDKLEKLAEDLPPNTLDELIDELGGPENVAEMTGRKGRVVSNDDGSISYESR    841 - 910
SELDVPVEILNITEKQRFMDGDKNIAIISEAASSGISLQADRRAKNQRRRVHMTLELPWSADRAIQQFGR    911 - 980
THRSNQVTAPEYVFLISELAGEQRFASIVAKRLESLGALTHGDRRATESRDLSRFNFDNKYGRNALEIVM    981 - 1050
KSIVNLDSPMVSPPPDYPGEFFKDVRQGLIGVGLINVEDRSGILTLDKDYNNIGKFLNRILGMEVHQQNA   1051 - 1120
LFQYFADTLTAVVQNAKKNGRYDMGILDLGSGDEKVRKSDVKKFLTPGYSTSGHVELYTISVERGMSWEE   1121 - 1190
ATKIWAELTGPDDGFYLSLQIRNNKKTAILVKEVNPKKKLFLVYRPNTGKQLKLEIYADLKKKYKKVVSD   1191 - 1260
DALMHWLDQYNSSADTCTHAYWRGNCKKASLGLVCEIGLRCRTYYVLCGSVLSVWTKVEGVLASVSGTNV   1261 - 1330
KMQIVRLRTEDGQRIVGLIIPANCVSPLVNLLSTSDQSQQLAVQQKQLWQQHHPQSITNLSNA          1331 - 1393
//

Text Mined References (25)

PMID Year Title