Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.30
PubTator Score 284.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Schizophrenia 503
Disease Target Count P-value
ependymoma 2514 8.76508728467202E-8
pilocytic astrocytoma 3086 3.65861095852897E-6
glioblastoma 5572 6.51441092681928E-6
adult high grade glioma 2148 9.50725035552772E-6
atypical teratoid / rhabdoid tumor 4369 1.34467610615086E-5
lung cancer 4473 1.07217795320797E-4
osteosarcoma 7933 2.70723256208761E-4
ovarian cancer 8492 8.58946314489474E-4
medulloblastoma, large-cell 6234 0.00111817938982901
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00119597817049452
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00196068877564661
medulloblastoma 1524 0.00779071917690462
subependymal giant cell astrocytoma 2287 0.0144891009090732
Rheumatoid Arthritis 1171 0.0206669692971655
astrocytic glioma 2241 0.0234284899136882
oligodendroglioma 2849 0.0319345497288043
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (16)

Synonym

Accession A3KN83 Q05C06 Q3ZTS3 Q9H3T8 Q9NVB2
Symbols Sno
MOP3

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Fruitfly OMA Inparanoid

Gene RIF (2)

PMID Text
22449796 Enhanced expression of Cdx2 by stimulation with bile acids may induce intestinal differentiation of esophageal columnar cells by interaction with the Notch signaling pathway.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MVEPGQDLLLAALSESGISPNDLFDIDGGDAGLATPMPTPSVQQSVPLSALELGLETEAAVPVKQEPETV      1 - 70
PTPALLNVRQQPPSTTTFVLNQINHLPPLGSTIVMTKTPPVTTNRQTITLTKFIQTTASTRPSVSAPTVR     71 - 140
NAMTSAPSKDQVQLKDLLKNNSLNELMKLKPPANIAQPVATAATDVSNGTVKKESSNKEGARMWINDMKM    141 - 210
RSFSPTMKVPVVKEDDEPEEEDEEEMGHAETYAEYMPIKLKIGLRHPDAVVETSSLSSVTPPDVWYKTSI    211 - 280
SEETIDNGWLSALQLEAITYAAQQHETFLPNGDRAGFLIGDGAGVGKGRTIAGIIYENYLLSRKRALWFS    281 - 350
VSNDLKYDAERDLRDIGAKNILVHSLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQSGGKYKTRLKQ    351 - 420
LLHWCGDDFDGVIVFDECHKAKNLCPVGSSKPTKTGLAVLELQNKLPKARVVYASATGASEPRNMAYMNR    421 - 490
LGIWGEGTPFREFSDFIQAVERRGVGAMEIVAMDMKLRGMYIARQLSFTGVTFKIEEVLLSQSYVKMYNK    491 - 560
AVKLWVIARERFQQAADLIDAEQRMKKSMWGQFWSAHQRFFKYLCIASKVKRVVQLAREEIKNGKCVVIG    561 - 630
LQSTGEARTLEALEEGGGELNDFVSTAKGVLQSLIEKHFPAPDRKKLYSLLGIDLTAPSNNSSPRDSPCK    631 - 700
ENKIKKRKGEEITREAKKARKVGGLTGSSSDDSGSESDASDNEESDYESSKNMSSGDDDDFNPFLDESNE    701 - 770
DDENDPWLIRKDHKKNKEKKKKKSIDPDSIQSALLASGLGSKRPSFSSTPVISPAPNSTPANSNTNSNSS    771 - 840
LITSQDAVERAQQMKKDLLDKLEKLAEDLPPNTLDELIDELGGPENVAEMTGRKGRVVSNDDGSISYESR    841 - 910
SELDVPVEILNITEKQRFMDGDKNIAIISEAASSGISLQADRRAKNQRRRVHMTLELPWSADRAIQQFGR    911 - 980
THRSNQVTAPEYVFLISELAGEQRFASIVAKRLESLGALTHGDRRATESRDLSRFNFDNKYGRNALEIVM    981 - 1050
KSIVNLDSPMVSPPPDYPGEFFKDVRQGLIGVGLINVEDRSGILTLDKDYNNIGKFLNRILGMEVHQQNA   1051 - 1120
LFQYFADTLTAVVQNAKKNGRYDMGILDLGSGDEKVRKSDVKKFLTPGYSTSGHVELYTISVERGMSWEE   1121 - 1190
ATKIWAELTGPDDGFYLSLQIRNNKKTAILVKEVNPKKKLFLVYRPNTGKQLKLEIYADLKKKYKKVVSD   1191 - 1260
DALMHWLDQYNSSADTCTHAYWRGNCKKASLGLVCEIGLRCRTYYVLCGSVLSVWTKVEGVLASVSGTNV   1261 - 1330
KMQIVRLRTEDGQRIVGLIIPANCVSPLVNLLSTSDQSQQLAVQQKQLWQQHHPQSITNLSNA          1331 - 1393
//

Text Mined References (24)

PMID Year Title
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22504419 2012 Common variants at 12q15 and 12q24 are associated with infant head circumference.
22449796 2012 Notch signaling pathway and Cdx2 expression in the development of Barrett's esophagus.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
More...