Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

AA Sequence

MMLPQWLLLLFLLFFFLFLLTRGSLSPTKYNLLELKESCIRNQDCETGCCQRAPDNCESHCAEKGSEGSL      1 - 70
CQTQVFFGQYRACPCLRNLTCIYSKNEKWLSIAYGRCQKIGRQKLAKKMFF                        71 - 121
//

Text Mined References (5)

PMID Year Title
18390568 2008 Transcriptome analysis of a cDNA library from adult human epididymis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.