Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.95
PubTator Score 1.91

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
acute myeloid leukemia 1.500 4.7e-02
atypical teratoid / rhabdoid tumor -1.100 6.6e-06
Chronic Lymphocytic Leukemia -1.518 1.5e-07
group 4 medulloblastoma -1.100 3.6e-04
interstitial cystitis 1.300 6.4e-04
lung adenocarcinoma -1.200 4.8e-14
lung cancer -1.700 1.4e-03
lung carcinoma -2.600 1.2e-32
non-small cell lung cancer -2.056 6.1e-31
osteosarcoma -1.172 1.2e-02
spina bifida 1.410 3.7e-02

Gene RIF (3)

AA Sequence

MRSLRKKREKPRPEQWKGLPGPPRAPEPEDVAVPGGVDLLTLPQLCFPGGVCVATEPKEDCVHFLVLTDV      1 - 70
CGNRTYGVVAQYYRPLHDEYCFYNGKTHRECPGCFVPFAVCVVSRFPYYNSLKDCLSCLLALLKPCKDFE     71 - 140
VDSHIKDFAAKLSLIPSPPPGPLHLVFNMKSLQIVLPARADPESPILDLDLHLPLLCFRPEKVLQILTCI    141 - 210
LTEQRIVFFSSDWALLTLVTECFMAYLYPLQWQHPFVPILSDQMLDFVMAPTSFLMGCHLDHFEEVSKEA    211 - 280
DGLVLINIDHGSITYSKSTDDNVDIPDVPLLAAQTFIQRVQSLQLHHELHAAHLLSSTDLKEGRAHRRSW    281 - 350
QQKLNCQIQQTTLQLLVSIFRDVKNHLNYEHRVFNSEEFLKTRAPGDHQFYKQVLDTYMFHSFLKARLNR    351 - 420
RMDAFAQMDLDTQSEEDRINGMLLSPRRPTVEKRASRKSSHLHVTHRRMVVSMPNLQDIAMPELAPRNSS    421 - 490
LRLTDTAGCRGSSAVLNVTPKSPYTFKIPEIHFPLESKCVQAYHAHFVSMLSEAMCFLAPDNSLLLARYL    491 - 560
YLRGLVYLMQGQLLNALLDFQNLYKTDIRIFPTDLVKRTVESMSAPEWEGAEQAPELMRLISEILDKPHE    561 - 630
ASKLDDHVKKFKLPKKHMQLGDFMKRVQESGIVKDASIIHRLFEALTVGQEKQIDPETFKDFYNCWKETE    631 - 700
AEAQEVSLPWLVMEHLDKNECVCKLSSSVKTNLGVGKIAMTQKRLFLLTEGRPGYLEISTFRNIEEVRRT    701 - 770
TTTFLLRRIPTLKIRVASKKEVFEANLKTECDLWHLMVKEMWAGKKLADDHKDPHYVQQALTNVLLMDAV    771 - 840
VGTLQSPGAIYAASKLSYFDKMSNEMPMTLPETTLETLKHKINPSAGEAFPQAVDVLLYTPGHLDPAEKV    841 - 910
EDAHPKLWCALSEGKVTVFNASSWTIHQHSFKVGTAKVNCMVMADQNQVWVGSEDSVIYIINVHSMSCNK    911 - 980
QLTAHCSSVTDLIVQDGQEAPSNVYSCSMDGMVLVWNVSTLQVTSRFQLPRGGLTSIRLHGGRLWCCTGN    981 - 1050
SIMVMKMNGSLHQELKIEENFKDTSTSFLAFQLLPEEEQLWAACAGRSEVYIWSLKDLAQPPQRVPLEDC   1051 - 1120
SEINCMIRVKKQVWVGSRGLGQGTPKGKIYVIDAERKTVEKELVAHMDTVRTLCSAEDRYVLSGSGREEG   1121 - 1190
KVAIWKGE                                                                 1191 - 1198
//

Text Mined References (12)

PMID Year Title