Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.43
PubTator Score 1.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Chronic Lymphocytic Leukemia -1.518 0.000
osteosarcoma -3.063 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
medulloblastoma -1.100 0.000
non-small cell lung cancer -2.056 0.000
lung cancer -2.600 0.000
interstitial cystitis 1.300 0.001
lung adenocarcinoma -1.900 0.000
lung carcinoma -2.600 0.000
spina bifida 1.410 0.037
acute myeloid leukemia 1.600 0.002

Gene RIF (2)

PMID Text
25925668 a novel signaling pathway identified whereby starvation-induced activation of ULK leads to phosphorylation of endogenous DENND3, with subsequent activation of Rab12 and initiation of membrane trafficking events required for autophagy
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MRSLRKKREKPRPEQWKGLPGPPRAPEPEDVAVPGGVDLLTLPQLCFPGGVCVATEPKEDCVHFLVLTDV      1 - 70
CGNRTYGVVAQYYRPLHDEYCFYNGKTHRECPGCFVPFAVCVVSRFPYYNSLKDCLSCLLALLKPCKDFE     71 - 140
VDSHIKDFAAKLSLIPSPPPGPLHLVFNMKSLQIVLPARADPESPILDLDLHLPLLCFRPEKVLQILTCI    141 - 210
LTEQRIVFFSSDWALLTLVTECFMAYLYPLQWQHPFVPILSDQMLDFVMAPTSFLMGCHLDHFEEVSKEA    211 - 280
DGLVLINIDHGSITYSKSTDDNVDIPDVPLLAAQTFIQRVQSLQLHHELHAAHLLSSTDLKEGRAHRRSW    281 - 350
QQKLNCQIQQTTLQLLVSIFRDVKNHLNYEHRVFNSEEFLKTRAPGDHQFYKQVLDTYMFHSFLKARLNR    351 - 420
RMDAFAQMDLDTQSEEDRINGMLLSPRRPTVEKRASRKSSHLHVTHRRMVVSMPNLQDIAMPELAPRNSS    421 - 490
LRLTDTAGCRGSSAVLNVTPKSPYTFKIPEIHFPLESKCVQAYHAHFVSMLSEAMCFLAPDNSLLLARYL    491 - 560
YLRGLVYLMQGQLLNALLDFQNLYKTDIRIFPTDLVKRTVESMSAPEWEGAEQAPELMRLISEILDKPHE    561 - 630
ASKLDDHVKKFKLPKKHMQLGDFMKRVQESGIVKDASIIHRLFEALTVGQEKQIDPETFKDFYNCWKETE    631 - 700
AEAQEVSLPWLVMEHLDKNECVCKLSSSVKTNLGVGKIAMTQKRLFLLTEGRPGYLEISTFRNIEEVRRT    701 - 770
TTTFLLRRIPTLKIRVASKKEVFEANLKTECDLWHLMVKEMWAGKKLADDHKDPHYVQQALTNVLLMDAV    771 - 840
VGTLQSPGAIYAASKLSYFDKMSNEMPMTLPETTLETLKHKINPSAGEAFPQAVDVLLYTPGHLDPAEKV    841 - 910
EDAHPKLWCALSEGKVTVFNASSWTIHQHSFKVGTAKVNCMVMADQNQVWVGSEDSVIYIINVHSMSCNK    911 - 980
QLTAHCSSVTDLIVQDGQEAPSNVYSCSMDGMVLVWNVSTLQVTSRFQLPRGGLTSIRLHGGRLWCCTGN    981 - 1050
SIMVMKMNGSLHQELKIEENFKDTSTSFLAFQLLPEEEQLWAACAGRSEVYIWSLKDLAQPPQRVPLEDC   1051 - 1120
SEINCMIRVKKQVWVGSRGLGQGTPKGKIYVIDAERKTVEKELVAHMDTVRTLCSAEDRYVLSGSGREEG   1121 - 1190
KVAIWKGE                                                                 1191 - 1198
//

Text Mined References (11)

PMID Year Title
25925668 2015 Phosphorylation of the exchange factor DENND3 by ULK in response to starvation activates Rab12 and induces autophagy.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21502966 2012 Single-nucleotide polymorphisms in HLA- and non-HLA genes associated with the development of antibodies to interferon-? therapy in multiple sclerosis patients.
20937701 2010 Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
More...