Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.10
PubTator Score 0.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.500 9.1e-07
astrocytic glioma -1.300 1.1e-02
Astrocytoma, Pilocytic -1.300 1.4e-08
atypical teratoid / rhabdoid tumor -2.000 6.0e-08
Breast cancer 3.900 4.2e-02
cutaneous lupus erythematosus -1.400 4.1e-04
ependymoma -1.600 2.2e-02
glioblastoma -1.500 1.9e-09
group 3 medulloblastoma -1.200 3.4e-04
lung cancer 1.900 1.3e-02
malignant mesothelioma -1.700 1.1e-05
medulloblastoma, large-cell -1.100 1.5e-03
oligodendroglioma -1.300 2.8e-02
osteosarcoma -1.741 3.4e-04
Pick disease -1.100 1.2e-03
psoriasis -1.300 2.9e-08
subependymal giant cell astrocytoma -1.778 4.7e-03

Synonym

Accession A2RU67 Q49AF2 Q5CZ81 Q6ZUV7 Q9P261
Symbols KIAA1467

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MATVLSRALKLPGKKSPDLGEYDPLTQADSDESEDDLVLNLQKNGGVKNGKSPLGEAPEPDSDAEVAEAA      1 - 70
KPHLSEVTTEGYPSEPLGGLEQKAASSLVSYVRTSVFLLTLGISMILVLLCAFLIPCPPRDLHSTWSRHL     71 - 140
GSQGGGDLSPLELADVNGDGLRDVLLSFVMSRNGSAVGVSRPAANLVCLSGMNGSTLWSSLLPEEARDIT    141 - 210
CLELMPGSLAETICLVTGTHKMLSAFNATSGKAIWTLNPNYLSNGTLAAPVVVLPDLDEDGVRDLVVLAI    211 - 280
GELQPDLCFLLVSGRTGNPVGRPVKYNIVGVGNLIGPQVYITTNGAVYILFGFGNIQAVALRDIFVQAQN    281 - 350
RDSSPPSLQIEEPEWEKRRSINLSELIDVYSDGVELLQMVKAPDSNCSNLLITTRQSLVLLRGQNLTPYW    351 - 420
ALRLQGLRSQPTPGYFTDDQTLDFLLQIQDGVGMKKMMVVDGDSGSIVWSYRAPCHMKETPATSAVTSDQ    421 - 490
KSVFLFWAEGLSAASPNSDIILGTEPPSLHHLYLLHPAFPSILLDLANTTGTVTASEVGINDLWKDAFYV    491 - 560
TRTTGPSSEGHPAALVVSKLSLRWALMEGQMAQLQESTPKIGRGELRRFLSRIKFVEAPYEI            561 - 622
//

Text Mined References (11)

PMID Year Title