Property Summary

NCBI Gene PubMed Count 21
PubMed Score 7.02
PubTator Score 4.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

Gene RIF (10)

AA Sequence

MSSGNYQQSEALSKPTFSEEQASALVESVFGLKVSKVRPLPSYDDQNFHVYVSKTKDGPTEYVLKISNTK      1 - 70
ASKNPDLIEVQNHIIMFLKAAGFPTASVCHTKGDNTASLVSVDSGSEIKSYLVRLLTYLPGRPIAELPVS     71 - 140
PQLLYEIGKLAAKLDKTLQRFHHPKLSSLHRENFIWNLKNVPLLEKYLYALGQNRNREIVEHVIHLFKEE    141 - 210
VMTKLSHFRECINHGDLNDHNILIESSKSASGNAEYQVSGILDFGDMSYGYYVFEVAITIMYMMIESKSP    211 - 280
IQVGGHVLAGFESITPLTAVEKGALFLLVCSRFCQSLVMAAYSCQLYPENKDYLMVTAKTGWKHLQQMFD    281 - 350
MGQKAVEEIWFETAKSYESGISM                                                   351 - 373
//

Text Mined References (24)

PMID Year Title