Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.4e-04

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.291 1.4e-04

AA Sequence

MAQSDFLYPENPKRREEVNRLHQQLLDCLSDSFDVTNKLTEVLNMHLGCRLASIEMKRDGTIKENCDLII      1 - 70
QAIMKIQKELQKVDEALKDKLEPTLYRKLQDIKEKETDKIAIVQKVISVILGEATSAASAVAVKLVGSNV     71 - 140
TTGIINKLVTVLAQIGASLLGSIGVAVLGLGIDMIVRAILGAVEKTQLQAAIKSYEKHLVEFKSASEKYN    141 - 210
HAITEVINTVKHQMK                                                           211 - 225
//

Text Mined References (7)

PMID Year Title