Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Motor neuron disease 49 0.0 0.8

Synonym

Accession A2RU37
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MWSRRGLGVSRAPLHLLLGVWGPSGRTGGQRKGASLARPGRGGLASCSVGANGKRDVLFLRKTLTNTVED      1 - 70
IQIDNFRRKSDLGVGSPDWKNLLIDVTREDHENSQNNSKRRCKVNCETDQR                        71 - 121
//

Text Mined References (3)

PMID Year Title