Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.91
PubTator Score 5.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -2.400 0.002
posterior fossa group B ependymoma -3.400 0.000
oligodendroglioma -2.300 0.017
glioblastoma -4.200 0.000
osteosarcoma -3.109 0.000
medulloblastoma -4.600 0.000
atypical teratoid / rhabdoid tumor -4.500 0.000
medulloblastoma, large-cell -4.400 0.002
primitive neuroectodermal tumor -4.700 0.000
pediatric high grade glioma -3.000 0.001
pilocytic astrocytoma -3.300 0.000
Pick disease -1.600 0.030

Synonym

Accession A2RU30 B4DPM3 B4E048 B7Z9K7 O94849 Q4G0P2 Q9P0C4
Symbols HSPC257
KIAA0748

Gene

Gene RIF (6)

PMID Text
25736038 Tespa1 hay have a role in susceptibility but not severity of rheumatoid arthritis in the Zhejiang Han population in China
24893580 The TESPA1 gene was found to not be involved in ankylosing spondylitis in a Chinese population.
23541577 Tespa1 is post-translationally modified upon intracellular divalent calcium-ion Ca2+ increase in thymocytes.
23501103 Tespa1 is a novel component of mitochondria-associated endoplasmic reticulum membranes and affects mitochondrial calcium flux.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEASVLSPTSWEKRRAWLRQSRNWQTQVLEEEAAAALQDVPDPEPSSLDDVFQEGNPINKIEDWLQDCGY      1 - 70
SEEGFSEEAGQFIYNGFCSHGTSFEDDLTLGAEATLLAANGKLFSRSFLETARPCQLLDLGCSLASSSMT     71 - 140
GGTNKTSSSISEILDKVQEDAEDVLFSLGFGQEDHKDTSRIPARFFTTPSQAKGIDFQLFLKSQVRRIEM    141 - 210
EDPCLMLASRFKQVQTLAVTADAFFCLYSYVSKTPVQKFTPSHMFWNCNHPTDVPSIRILSREPEPQSPR    211 - 280
DRLRKAISKMCLYTCPRDRPPPPHNTPKRNSLDQVVLEVMDKVKEEKQFLQQDSDLGQFSQEDPVPPAEG    281 - 350
KKLPTSPYPCVFCCEEETQQRMSTVLAPSQTLDSNPKVPCCTHSLPIEDPQWSTDPAQIRRELCSLPATN    351 - 420
TETHPAKDETFWKRKSRARKSLFQKNLMGRKVKSLDLSITQQKWKQSVDRPELRRSLSQQPQDTFDLEEV    421 - 490
QSNSEEEQSQSRWPSRPRHPHHHQTFAGKDS                                           491 - 521
//

Text Mined References (14)

PMID Year Title
25736038 2015 Tespa1 is associated with susceptibility but not severity of rheumatoid arthritis in the Zhejiang Han population in China.
24893580 2014 Lack of association between TESPA1 gene polymorphisms (rs1801876, rs2171497, rs4758994, and rs997173) and ankylosing spondylitis in a Chinese population.
23650607 2012 Tespa1 is a novel inositol 1,4,5-trisphosphate receptor binding protein in T and B lymphocytes.
23541577 2013 Tespa1 protein is phosphorylated in response to store-operated calcium entry.
23501103 2013 Tespa1 is a novel component of mitochondria-associated endoplasmic reticulum membranes and affects mitochondrial calcium flux.
22561606 2012 Tespa1 is involved in late thymocyte development through the regulation of TCR-mediated signaling.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
16541075 2006 The finished DNA sequence of human chromosome 12.
More...