Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.06
PubTator Score 0.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.300 2.1e-05
Astrocytoma, Pilocytic 1.200 2.5e-07
atypical teratoid / rhabdoid tumor 1.400 2.8e-09
ependymoma 1.900 1.9e-20
glioblastoma 1.500 2.8e-12
group 3 medulloblastoma 1.700 2.8e-05
medulloblastoma, large-cell 1.300 1.2e-03
ovarian cancer -1.200 1.4e-05
primitive neuroectodermal tumor 1.400 1.9e-04
tuberculosis 1.400 4.1e-04

Synonym

Accession A2RU14 B7ZM48
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MAGTVLGVGAGVFILALLWVAVLLLCVLLSRASGAARFSVIFLFFGAVIITSVLLLFPRAGEFPAPEVEV      1 - 70
KIVDDFFIGRYVLLAFLSAIFLGGLFLVLIHYVLEPIYAKPLHSY                              71 - 115
//

Text Mined References (5)

PMID Year Title