Property Summary

NCBI Gene PubMed Count 6
PubMed Score 25.26
PubTator Score 4.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.300 4.5e-04
atypical teratoid / rhabdoid tumor -1.500 2.0e-03
cystic fibrosis -1.049 7.9e-04
Duchenne muscular dystrophy -1.086 1.1e-08
ependymoma -1.100 3.0e-04
glioblastoma -1.300 6.1e-03
medulloblastoma, large-cell -1.200 4.2e-05
osteosarcoma -1.522 9.8e-05
ovarian cancer -1.100 1.2e-03
Pick disease -1.100 7.7e-04
progressive supranuclear palsy -1.200 1.3e-02

Gene RIF (2)

AA Sequence

MAAEALAAEAVASRLERQEEDIRWLWSEVERLRDEQLNAPYSCQAEGPCLTREVAQLRAENCDLRHRLCS      1 - 70
LRLCLAEERSRQATLESAELEAAQEAGAQPPPSQSQDKDMKKKKMKESEADSEVKHQPIFIKERLKLFEI     71 - 140
LKKDHQLLLAIYGKKGDTSNIITVRVADGQTVQGEVWKTTPYQVAAEISQELAESTVIAKVNGELWDLDR    141 - 210
PLEGDSSLELLTFDNEEAQAVYWHSSAHILGEAMELYYGGHLCYGPPIENGFYYDMFIEDRAVSSTELSA    211 - 280
LENICKAIIKEKQPFERLEVSKEILLEMFKYNKFKCRILNEKVNTATTTVYRCGPLIDLCKGPHVRHTGK    281 - 350
IKTIKIFKNSSTYWEGNPEMETLQRIYGISFPDNKMMRDWEKFQEEAKNRDHRKIGKEQELFFFHDLSPG    351 - 420
SCFFLPRGAFIYNTLTDFIREEYHKRDFTEVLSPNMYNSKLWEASGHWQHYSENMFTFEIEKDTFALKPM    421 - 490
NCPGHCLMFAHRPRSWREMPIRFADFGVLHRNELSGTLSGLTRVRRFQQDDAHIFCTVEQIEEEIKGCLQ    491 - 560
FLQSVYSTFGFSFQLNLSTRPENFLGEIEMWNEAEKQLQNSLMDFGEPWKMNPGDGAFYGPKIDIKIKDA    561 - 630
IGRYHQCATIQLDFQLPIRFNLTYVSKDGDDKKRPVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQV    631 - 700
MVIPVGPTCEKYALQVSSEFFEEGFMADVDLDHSCTLNKKIRNAQLAQYNFILVVGEKEKIDNAVNVRTR    701 - 770
DNKIHGEILVTSAIDKLKNLRKTRTLNAEEAF                                          771 - 802
//

Text Mined References (10)

PMID Year Title