Property Summary

NCBI Gene PubMed Count 6
PubMed Score 23.13
PubTator Score 4.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Duchenne muscular dystrophy 602 1.12457268538786E-8
medulloblastoma, large-cell 6234 4.15991157683255E-5
osteosarcoma 7933 9.78065659575792E-5
ependymoma 2514 2.95954829434142E-4
adult high grade glioma 2148 4.49125899303341E-4
Pick disease 1893 7.67175586680869E-4
cystic fibrosis 1670 7.89239128793079E-4
ovarian cancer 8492 0.00123861990567418
atypical teratoid / rhabdoid tumor 4369 0.00204170804364694
glioblastoma 5572 0.00609703385598384
progressive supranuclear palsy 674 0.0134538887323787
Disease Target Count Z-score Confidence
Myositis 24 4.494 2.2
Nonspecific interstitial pneumonia 5 3.591 1.8

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma -1.522 0.000
ependymoma -1.100 0.000
cystic fibrosis -1.049 0.001
atypical teratoid / rhabdoid tumor -1.500 0.002
glioblastoma -1.300 0.006
medulloblastoma, large-cell -1.200 0.000
Duchenne muscular dystrophy -1.086 0.000
adult high grade glioma -1.300 0.000
Pick disease -1.100 0.001
progressive supranuclear palsy -1.200 0.013
ovarian cancer -1.100 0.001

Synonym

Accession A2RTX5 B2RMP7 Q6B0A1 Q6IS76 Q96LW3 Q96MP4
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (2)

PMID Text
24312579 TARSL2 is potentially a new component of aminoacyl-tRNA synthetase core-complex
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAAEALAAEAVASRLERQEEDIRWLWSEVERLRDEQLNAPYSCQAEGPCLTREVAQLRAENCDLRHRLCS      1 - 70
LRLCLAEERSRQATLESAELEAAQEAGAQPPPSQSQDKDMKKKKMKESEADSEVKHQPIFIKERLKLFEI     71 - 140
LKKDHQLLLAIYGKKGDTSNIITVRVADGQTVQGEVWKTTPYQVAAEISQELAESTVIAKVNGELWDLDR    141 - 210
PLEGDSSLELLTFDNEEAQAVYWHSSAHILGEAMELYYGGHLCYGPPIENGFYYDMFIEDRAVSSTELSA    211 - 280
LENICKAIIKEKQPFERLEVSKEILLEMFKYNKFKCRILNEKVNTATTTVYRCGPLIDLCKGPHVRHTGK    281 - 350
IKTIKIFKNSSTYWEGNPEMETLQRIYGISFPDNKMMRDWEKFQEEAKNRDHRKIGKEQELFFFHDLSPG    351 - 420
SCFFLPRGAFIYNTLTDFIREEYHKRDFTEVLSPNMYNSKLWEASGHWQHYSENMFTFEIEKDTFALKPM    421 - 490
NCPGHCLMFAHRPRSWREMPIRFADFGVLHRNELSGTLSGLTRVRRFQQDDAHIFCTVEQIEEEIKGCLQ    491 - 560
FLQSVYSTFGFSFQLNLSTRPENFLGEIEMWNEAEKQLQNSLMDFGEPWKMNPGDGAFYGPKIDIKIKDA    561 - 630
IGRYHQCATIQLDFQLPIRFNLTYVSKDGDDKKRPVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQV    631 - 700
MVIPVGPTCEKYALQVSSEFFEEGFMADVDLDHSCTLNKKIRNAQLAQYNFILVVGEKEKIDNAVNVRTR    701 - 770
DNKIHGEILVTSAIDKLKNLRKTRTLNAEEAF                                          771 - 802
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24312579 2013 Reinvestigation of aminoacyl-tRNA synthetase core complex by affinity purification-mass spectrometry reveals TARSL2 as a potential member of the complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.