Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.29
PubTator Score 1.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
osteosarcoma 7933 1.6498010894814E-8
hepatocellular carcinoma 550 3.96240139571093E-5
sonic hedgehog group medulloblastoma 1482 6.78978479681683E-5
head and neck cancer 270 5.25893993166137E-4
glioblastoma 5572 5.5464269996428E-4
interstitial cystitis 2299 6.5740080921358E-4
gastric cancer 436 7.68309389404136E-4
atypical teratoid/rhabdoid tumor 1095 0.00571813053934694
ovarian cancer 8492 0.0116205887561565
adrenocortical carcinoma 1427 0.0165641081674758
invasive ductal carcinoma 2950 0.0310212913340169
Disease Target Count Z-score Confidence
lung cancer 4473 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0

Expression

  Differential Expression (11)

Disease log2 FC p
gastric cancer 1.500 0.001
hepatocellular carcinoma 1.100 0.000
osteosarcoma -2.312 0.000
glioblastoma 1.100 0.001
sonic hedgehog group medulloblastoma 2.000 0.000
adrenocortical carcinoma 1.041 0.017
interstitial cystitis -1.700 0.001
atypical teratoid/rhabdoid tumor 1.100 0.006
invasive ductal carcinoma 1.100 0.031
ovarian cancer 1.100 0.012
head and neck cancer -1.100 0.001

Synonym

Accession A2RRD8 Q8NDR6
Symbols ZFPL

Gene

  Ortholog (2)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG

AA Sequence

MALSQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKCMMNTLSSTGQGNTEVIH      1 - 70
TGTLQRQASYHIGAFCSQEIEKDIHDFVFQWQEDETNDHEAPMTEIKKLTSSTDRYDQRHAGNKPIKGQL     71 - 140
ESRFHLHLRRHRRIHTGEKPYKCEECEKVFSCKSHLEIHRIIHTGEKPYKCKVCDKAFKHDSHLAKHTRI    141 - 210
HRGDKHYTCNECGKVFDQKATLACHHRSHTGEKPYKCNECGKTFSQTSHLVYHHRLHTGEKPYKCNECGK    211 - 280
TFARNSVLVIHKAVHTAEKPYKCNECGKVFKQRATLAGHRRVHTGEKPYRCEECDKVFSRKSHLERHRRI    281 - 350
HTGEKPYKCKVCDKAFRSDSRLAEHQRVHTGERPYTCNECGKVFSTKAYLACHQKLHTGEKLYECEECDK    351 - 420
VYIRKSHLERHRRIHTGEKPHKCGDCGKAFNSPSHLIRHQRIHTGQKSYKCHQCGKVFSLRSLLAEHQKI    421 - 490
PFGDNCFKCNEYSKPSSIN                                                       491 - 509
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22005930 2012 Genome-wide association study of Alzheimer's disease with psychotic symptoms.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11536051 2001 A novel member of the WD-repeat gene family, WDR11, maps to the 10q26 region and is disrupted by a chromosome translocation in human glioblastoma cells.