Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.30
PubTator Score 1.06

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
adrenocortical carcinoma 1.041 1.7e-02
atypical teratoid/rhabdoid tumor 1.100 5.7e-03
gastric cancer 1.500 7.7e-04
glioblastoma 1.100 5.5e-04
group 3 medulloblastoma 1.500 3.9e-02
head and neck cancer -1.100 5.3e-04
hepatocellular carcinoma 1.100 4.0e-05
interstitial cystitis -1.700 6.6e-04
invasive ductal carcinoma 1.100 3.1e-02
osteosarcoma -2.312 1.6e-08
ovarian cancer 1.100 1.2e-02

AA Sequence

MALSQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKCMMNTLSSTGQGNTEVIH      1 - 70
TGTLQRQASYHIGAFCSQEIEKDIHDFVFQWQEDETNDHEAPMTEIKKLTSSTDRYDQRHAGNKPIKGQL     71 - 140
ESRFHLHLRRHRRIHTGEKPYKCEECEKVFSCKSHLEIHRIIHTGEKPYKCKVCDKAFKHDSHLAKHTRI    141 - 210
HRGDKHYTCNECGKVFDQKATLACHHRSHTGEKPYKCNECGKTFSQTSHLVYHHRLHTGEKPYKCNECGK    211 - 280
TFARNSVLVIHKAVHTAEKPYKCNECGKVFKQRATLAGHRRVHTGEKPYRCEECDKVFSRKSHLERHRRI    281 - 350
HTGEKPYKCKVCDKAFRSDSRLAEHQRVHTGERPYTCNECGKVFSTKAYLACHQKLHTGEKLYECEECDK    351 - 420
VYIRKSHLERHRRIHTGEKPHKCGDCGKAFNSPSHLIRHQRIHTGQKSYKCHQCGKVFSLRSLLAEHQKI    421 - 490
PFGDNCFKCNEYSKPSSIN                                                       491 - 509
//

Text Mined References (8)

PMID Year Title