Property Summary

NCBI Gene PubMed Count 206
PubMed Score 802.67
PubTator Score 2462.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count
Alzheimer Disease 10

Expression

  Differential Expression (26)

Disease log2 FC p
astrocytoma 2.200 4.0e-02
oligodendroglioma 1.100 3.8e-02
esophageal adenocarcinoma 1.300 2.5e-02
glioblastoma 2.000 3.0e-04
Duchenne muscular dystrophy 1.383 9.2e-06
Becker muscular dystrophy 1.349 4.3e-03
pancreatic ductal adenocarcinoma liver m... -2.011 1.1e-02
non-small cell lung cancer -1.824 3.3e-19
intraductal papillary-mucinous adenoma (... -2.000 5.4e-04
intraductal papillary-mucinous carcinoma... -2.900 5.9e-04
intraductal papillary-mucinous neoplasm ... -2.700 5.6e-04
lung cancer -2.900 1.8e-05
colon cancer -1.100 8.5e-03
lung adenocarcinoma -2.300 1.2e-10
pediatric high grade glioma 1.500 3.8e-05
pilocytic astrocytoma 1.800 2.5e-09
posterior fossa group A ependymoma 1.200 3.0e-06
subependymal giant cell astrocytoma 1.701 9.0e-03
lung carcinoma -1.400 2.6e-11
Breast cancer -1.200 1.8e-04
gastric carcinoma 1.600 1.8e-02
pterygium 1.300 4.2e-03
invasive ductal carcinoma -1.300 2.8e-04
ulcerative colitis 1.300 7.7e-04
ovarian cancer 1.800 1.1e-03
Gaucher disease type 3 -2.400 4.6e-02

Gene RIF (141)

PMID Text
27044074 These data demonstrate that alpha2M* and LRP1 modulate the BKCachannel in human myometrium and that BKCaand its immunomodulatory interacting partners regulate Ca(2+)dynamics in hMSMCs during pregnancy.
27002159 This work demonstrates that alpha2M*/CS-GRP78 acts as an upstream regulator of the PDK1/PLK1 signaling axis to modulate c-MYC transcription and its target genes, suggesting a therapeutic strategy for targeting c-MYC-associated malignant progression.
26217017 Alpha2M causes neurodegeneration in a p75(NTR)- and proNGF-dependent manner.
26134405 we identify a single serum factor, alpha2-macroglobulin (alpha2M), which is both required and sufficient for rosetting mediated by the parasite protein P. falciparum erythrocyte membrane protein 1 protein HB3VAR06 and some other rosette-mediating PfEMP1 proteins
25867373 Data indicate that the expression of salivary alpha2 macroglobulin (alpha2-M) showed a remarkable increase in type 2 diabetes mellitus (T2DM), which may be associated with functional disorders of the salivary gland.
25809189 A2M is expressed in the vasculature and NR4A receptors modulate VSMC MMP2/9 activity by several mechanisms including the up-regulation of A2M.
25574746 A2M is not the only biological candidate gene for AD determination
25495992 Meta-analysis. Our data indicate that the rs669 (A/G) polymorphisms in A2M gene are associated with increased risk in Parkinson disease.
24799681 alpha2M is a specialized chaperone that prevents the extracellular accumulation of misfolded and potentially pathogenic proteins, particularly during innate immune system activity
24756728 there is no enough evidence for associations of A2M gene polymorphisms (5 bp I/D, Ile1000Val) with Alzheimer's disease risk
24516643 phosphorylating the T-loop Akt residue Thr(308) by PDK1 requires Raptor of the mTORC1 complex as a platform or scaffold protein.
24093110 FEIgG and alpha2m/C are powerful predictors of outcome and responsiveness to steroids and cyclophosphamide; their predictive value, if validated in prospective studies, may be useful in clinical practice
24011543 genetic variation within the A2M gene influences CSF Ab42 levels.
23846698 A model is proposed that suggests that unlike proteases, which are irreversibly bound to activated alpha2M, hepcidin remains labile and available to down-regulate Fpn1.
23786280 Eosinophil activation occurred in early and late responses after L-ASA NPT in upper airway mucosa of AERD patients, where ApoA1, alpha2M and CP as well as CysLT may be involved in eosinophilic inflammation.
23721263 While activated alpha-2-microglobulin (AA2M) ligates only one GRP78 receptor molecule per AA2M, it may potentially serve as a reservoir for release of up to four binding fragments per molecule.
23643808 Oxidative stress and the levels of endogenous plasma prolyl oligopeptidase (PREP) inhibitor alpha-2-macroglobulin (alpha2M) decrease PREP activity in patients with multiple sclerosis.
23535567 Serum monomeric alpha2-macroglobulin is highly expressed in many diabetic subjects.
23397525 IGFBP-2 associates with alpha2-macroglobulin in the blood circulation.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of alpha-2-macroglobulin (A2M) in peptide-treated PBMCs
23379699 alpha2macroglobulin stimulates endothelial and early cardiac muscle differentiation of embryonic stem cells through generation of induction of FGF-2 expression.
23353684 protease-activated alpha2M has two mechanisms for inhibiting amyloid formation: via protease-alpha2M-mediated degradation of amyloidogenic substrates and by a chaperone action that prevents misfolded clients from continuing along the amyloid forming pathway.
23186781 There is no statistically significant difference in allele or genotype frequencies between patients with sporadic Alzheimer's disease and control subjects for the A2M polymorphism.
23089609 inhibitory activity of Aeromonas sobria serine protease by alpha2-macroglobulin
23086799 [review] alpha2M has many diversified and complex functions but is primarily known by its ability to inhibit a broad spectrum of proteases without the direct blockage of the protease active site.
23064953 Complexes between alpha2-macroglobulin and urokinase were detected in alveolar edema fluids as well as in lungs of patients with acute lung injury/acute respiratory distress syndrome where they were located mainly in close proximity to epithelial cells.
22971340 an isoform of ASP cleaved proteins more in plasma and was inhibited by human alpha(2)-macroglobulin more slowly than single-chain ASP
22576683 alpha-2-macroglobulin (a2M) deficiency develops from catabolism of a2M in androgen-dependent advanced prostate cancer patients
22541546 investigation of secondary structure and thermal stability of recombinant bodhesin 2, a spermadhesin from seminal plasma
21971609 We observed that the most informative biomarkers for predicting significant liver fibrosis in chronic hepatitis C patients were blood levels of alpha2-macroglobulin and hyaluronic acid
21642630 alpha2-macroglobulin is neurotoxic by inhibiting neuroprotective activity of nerve growth factor via TrkA receptors.
21541797 Identify a novel transcriptional regulatory element contributing to the up-regulation of alpha2M during replicative senescence.
21216953 dimeric alpha2M as well as tetrameric alpha2M may play an important role in controlling beta2-m amyloid fibril formation
20861575 statistically significant evidence of interaction between the polymorphisms in A2M, SLC6A4 and UCHL1 genes (global P = 0.0107, for the best model) and the risk for PD.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20637261 LRP1-C/T, A2M-Ile/Val and APOE-epsilon 2/epsilon 3/epsilon 4 polymorphisms are associated with AD.
20637261 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20587546 Observational study of gene-disease association. (HuGE Navigator)
20575108 Reduced expression of alpha-2 macroglobulin and complement factor B was detected in sera of patients with nasopharyngeal carcinoma.
20493925 Haplotype -88G/25G might play a protective role in the development of SAD, and the protective effects of -88G and 25G were independent of APOEvarepsilon4 allele.
20493925 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20401725 Ethnicity affects the genetic association of A2M with rheumatoid arthritis in South Asian and Caucasian patients living in East Midlands/United Kingdom.
20401725 Observational study of gene-disease association. (HuGE Navigator)
20381197 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20207732 SP-D utilizes a novel mechanism in which the collectin interacts with protease inhibitor A2M to decrease its degradation and to concurrently increase its innate immune function.
20156641 Galectin-3 Binding Protein and Alpha-2 macroglobulin were differentially expressed on DVT patients in microparticles extracted from platelet-poor plasma
20048078 LRP1 bound A2M* found to be associated with an inhibition of tumor cell proliferation, migration, invasion, spheroid formation, and anchorage-independent growth.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19639019 These data support an involvement of the suggested A2M risk haplotype in the pathogenesis of Alzheimer's disease and adds new evidence to the risk-allele depletion hypothesis.
19472074 The chaperone action of alpha-2-macroglobulin inhibits the toxicity and uptake of A beta in human cerebrospinal fluid
19105203 An ancestral risk haplotype clade in ACE and putative multilocus association between ACE, A2M, and LRRTM3 in Alzheimer disease.
19105203 Observational study of gene-disease association. (HuGE Navigator)
19074141 The chaperone action of alpha-2-macroglobulin targets prefibrillar species to inhibit amyloid formation
19074141 both alpha(2)M and Hp are likely to play an important role in controlling the inappropriate aggregation of proteins in the extracellular environment.
18706476 Observational study of gene-disease association. (HuGE Navigator)
18579803 Copper is taken up efficiently from albumin and alpha2-macroglobulin by cultured human cells by more than one mechanism.
18499670 effects of intact alpha(2)M on cell physiology reflect the degree of penetration of activities associated with different domains
18382889 Senile systemic amyloidosis was associated with age, myocardial infarctions, the G/G (Val/Val) genotype of the exon 24 polymorphism in the alpha2-macroglobulin (alpha2M), and the H2 haplotype of the tau gene
18382889 Observational study of gene-disease association. (HuGE Navigator)
18191876 A2M allele and genotype frequencies were similar between AD patients and controls.
18171086 Alpha-2-macroglobulin is an extracellular chaperone
18171086 alpha2M is a newly discovered and unique member of a small group of abundant extracellular proteins with chaperone properties
18077315 Decreased expression of alpha2-M mRNA and protein and protease inhibitory activity in the vaginal wall tissues of women with stress urinary incontinence(SUI) may contribute to the development of SUI.
18075673 The extracellular chaperone alpha-2-macroglobulin is likely to help control amyloid formation and toxicity in vivo
17967834 Alpha 2M activated by neutrophil elastase to its receptor-recognized form binds CpG ODN and enhances their immunostimulatory properties significantly.
17608619 expression and characterization of three alpha(2)M domains predicted to be involved in the stabilization of the thiol ester in native alpha2M and in its activation upon bait region proteolysis.
17453620 alpha2-macroglobulin may facilitate conformational changes in prion protein in spontaneous forms of prion disease
17403113 The risk of symptomatic thromboembolism was significantly increased with elevated alpha2MG levels.
17288987 alpha(2)M* binding to LRP-1 induces cell proliferation and MAPK activation in the J774 macrophage-derived cell line
17071617 bone morphogenetic protein 1 is inhibited by native and altered forms of alpha2-macroglobulin
16910174 Observational study of gene-disease association. (HuGE Navigator)
16910174 results did not support the hypothesis that A2M deletion polymorphism is associated with a low A2M concentration in overweight/obese subjects
16784755 Observational study of gene-disease association. (HuGE Navigator)
16784755 In this proteins two amino acid polymorphisms (Ile/Val A-->G) have been associated with an increased risk for Alzheimer's disease (AD) and the combination with CTSD-T allele seems to increase this risk.
16650578 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16641085 PDGF-BB and TGF-beta1 binding to intact alpha2M is specific, involving a defined region of the alpha2M subunit
16456795 Observational study of gene-disease association. (HuGE Navigator)
16407218 the inhibition of proteases on the surface of microorganisms by an ancestral alpha2M-like thiol ester protein may generate "arrays" of oligomannose glycans to which MBL or other lectins can bind
16402284 Observational study of gene-disease association. (HuGE Navigator)
16384981 Observational study of gene-disease association. (HuGE Navigator)
16297527 review of the A2M gene families of mice and humans, the predicted structural relationships between A2M and its pregnancy induced forms and the postulated roles for this gene family in normal pregnancy
16232083 results indicate that secondary proteolysis of alpha2-macroglobulin promotes impaired control of extracellular proteolytic activity, leading to local and distant tissue injuries during severe acute pancreatitis
16040006 Observational study of gene-disease association. (HuGE Navigator)
15931081 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
15931081 A2M gene was suggested to be associated with Alzheimer's disease.
15910735 These studies demonstrate that a single mutation in full-length r(alpha)2M is sufficient to block binding to LRP-1.
15908432 PAK-2 is activated in 1-LN prostate cancer cells by a proteinase inhibitor, alpha 2-macroglobulin
15793779 Results of this study revealed no association between the I1000V polymorphism of A2M and Chinese sporadic AD in Guangzhou and Chengdu.
15793779 Observational study of gene-disease association. (HuGE Navigator)
15611997 increased alpha(2)-macroglobulin expression appears to be associated with benign prostatic hyperplasia
15511627 an important involvement of alpha2M in regulation of increased proteolytic activity occurring in multiple sclerosis disease
15468911 Observational study of gene-disease association. (HuGE Navigator)
15023809 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15023809 The presence of MPO-G/G and A2M-Val/Val genotypes synergistically increased the risk of AD (OR, 25.5; 95% CI, 4.65-139.75).
14759632 Observational study of gene-disease association. (HuGE Navigator)
14715656 Alpha2-macroglobulin is a substrate and an endogenous inhibitor for ADAMTS-4 and ADAMTS-5
14678766 Plasma from patients homozygous for the intronic deletion (DD) showed normal alpha(2)M subunit size, conformation, and proteinase inhibitory activity. Plasma alpha(2)M from two DD patients showed markedly increased TGF-beta1 binding.
14675603 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14675603 A2M-D allele played a weak Alzheimer disease protective role, and APOE-E4 and A2M-G alleles might act synergistically in Alzheimer disease risk for mainland Han Chinese.
14637088 Observational study of gene-disease association. (HuGE Navigator)
14637088 alpha2-M deletion polymorphism is probably not associated with functional deficiencies important in Alzheimer's disease pathology
14506912 alpha2-macroglobulin inhibits human pepsin and gastricsin
12966032 There is a significant genetic association of the 5 bp deletion and two novel polymorphisms in alpha-2-macroglobulin alpha-2-macroglobulin precursor with AD
12782964 Observational study of gene-disease association. (HuGE Navigator)
12782337 Observational study of gene-disease association. (HuGE Navigator)
12755687 FGF-2 and this protein interact at specific binding sites, involving different FGF-2 sequences.
12755614 alpha(2)M-derived peptides target the receptor-binding sequence in TGF-beta
12631277 These results suggest the possible involvement of cathepsin E in disruption of the structural and functional integrity of alpha 2-macroglobulin in the endolysosome system.
12394648 Observational study of gene-disease association. (HuGE Navigator)
12221172 Observational study of gene-disease association. (HuGE Navigator)
12221172 Genetic association of alpha2-macroglobulin polymorphisms with Alzheimer's disease
12175343 Genetic association of argyrophilic grain disease with polymorphisms in alpha-2 macroglobulin.
12123860 Observational study of gene-disease association. (HuGE Navigator)
12062545 Alpha 2-macroglobulin enhances prothrombin activation and thrombin potential by inhibiting the anticoagulant protein C/protein S system in cord and adult plasma.
12059070 Observational study of gene-disease association. (HuGE Navigator)
12042276 relationship between serum VEGF levels, alpha(2)M levels and the development of OHSS in hyperstimulated subjects undergoing IVF
12015318 The three-dimensional structure of the dimer reveals its structural organization in the tetrameric native and chymotrypsin alpha 2-macroglobulin complexes.
11987698 Observational study of gene-disease association. (HuGE Navigator)
11910179 REVIEW: binds and neutralizes alfimeprase, which has direct proteolytic activity against the fibrinogen Aalpha chain
11901360 Observational study of gene-disease association. (HuGE Navigator)
11901360 has an important role in the AD-specific neurodegenerative process but its exon 24 Val-1000-Ile polymorphism is not likely to be associated with late-onset sporadic AD in the Hungarian population
11823454 distinct binding sites mediate interaction with beta-amyloid peptide and growth factors
11811950 Differential binding to ldl receptor related protein
11498265 Observational study of gene-disease association. (HuGE Navigator)
11496365 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11484172 Observational study of gene-disease association. (HuGE Navigator)
11455130 Observational study of gene-disease association. (HuGE Navigator)
11436125 Observational study of gene-disease association. (HuGE Navigator)
11290389 Observational study of gene-disease association. (HuGE Navigator)
11281447 Observational study of gene-disease association. (HuGE Navigator)
11231028 Observational study of gene-disease association. (HuGE Navigator)
11166925 Observational study of gene-disease association. (HuGE Navigator)
11121179 Observational study of gene-disease association. (HuGE Navigator)
11100124 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of alpha-2-macroglobulin (A2M) in peptide-treated PBMCs
11099722 Observational study of gene-disease association. (HuGE Navigator)
11058789 Observational study of gene-disease association. (HuGE Navigator)
11036822 Observational study of gene-disease association. (HuGE Navigator)
7690356 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of alpha-2-macroglobulin (A2M) in peptide-treated PBMCs
7524416 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of alpha-2-macroglobulin (A2M) in peptide-treated PBMCs
1724156 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of alpha-2-macroglobulin (A2M) in peptide-treated PBMCs

AA Sequence

MGKNKLLHPSLVLLLLVLLPTDASVSGKPQYMVLVPSLLHTETTEKGCVLLSYLNETVTVSASLESVRGN      1 - 70
RSLFTDLEAENDVLHCVAFAVPKSSSNEEVMFLTVQVKGPTQEFKKRTTVMVKNEDSLVFVQTDKSIYKP     71 - 140
GQTVKFRVVSMDENFHPLNELIPLVYIQDPKGNRIAQWQSFQLEGGLKQFSFPLSSEPFQGSYKVVVQKK    141 - 210
SGGRTEHPFTVEEFVLPKFEVQVTVPKIITILEEEMNVSVCGLYTYGKPVPGHVTVSICRKYSDASDCHG    211 - 280
EDSQAFCEKFSGQLNSHGCFYQQVKTKVFQLKRKEYEMKLHTEAQIQEEGTVVELTGRQSSEITRTITKL    281 - 350
SFVKVDSHFRQGIPFFGQVRLVDGKGVPIPNKVIFIRGNEANYYSNATTDEHGLVQFSINTTNVMGTSLT    351 - 420
VRVNYKDRSPCYGYQWVSEEHEEAHHTAYLVFSPSKSFVHLEPMSHELPCGHTQTVQAHYILNGGTLLGL    421 - 490
KKLSFYYLIMAKGGIVRTGTHGLLVKQEDMKGHFSISIPVKSDIAPVARLLIYAVLPTGDVIGDSAKYDV    491 - 560
ENCLANKVDLSFSPSQSLPASHAHLRVTAAPQSVCALRAVDQSVLLMKPDAELSASSVYNLLPEKDLTGF    561 - 630
PGPLNDQDNEDCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGP    631 - 700
EGLRVGFYESDVMGRGHARLVHVEEPHTETVRKYFPETWIWDLVVVNSAGVAEVGVTVPDTITEWKAGAF    701 - 770
CLSEDAGLGISSTASLRAFQPFFVELTMPYSVIRGEAFTLKATVLNYLPKCIRVSVQLEASPAFLAVPVE    771 - 840
KEQAPHCICANGRQTVSWAVTPKSLGNVNFTVSAEALESQELCGTEVPSVPEHGRKDTVIKPLLVEPEGL    841 - 910
EKETTFNSLLCPSGGEVSEELSLKLPPNVVEESARASVSVLGDILGSAMQNTQNLLQMPYGCGEQNMVLF    911 - 980
APNIYVLDYLNETQQLTPEIKSKAIGYLNTGYQRQLNYKHYDGSYSTFGERYGRNQGNTWLTAFVLKTFA    981 - 1050
QARAYIFIDEAHITQALIWLSQRQKDNGCFRSSGSLLNNAIKGGVEDEVTLSAYITIALLEIPLTVTHPV   1051 - 1120
VRNALFCLESAWKTAQEGDHGSHVYTKALLAYAFALAGNQDKRKEVLKSLNEEAVKKDNSVHWERPQKPK   1121 - 1190
APVGHFYEPQAPSAEVEMTSYVLLAYLTAQPAPTSEDLTSATNIVKWITKQQNAQGGFSSTQDTVVALHA   1191 - 1260
LSKYGAATFTRTGKAAQVTIQSSGTFSSKFQVDNNNRLLLQQVSLPELPGEYSMKVTGEGCVYLQTSLKY   1261 - 1330
NILPEKEEFPFALGVQTLPQTCDEPKAHTSFQISLSVSYTGSRSASNMAIVDVKMVSGFIPLKPTVKMLE   1331 - 1400
RSNHVSRTEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVKVYDYYETDEFAIAEYNAPCSKD   1401 - 1470
LGNA                                                                     1471 - 1474
//

Text Mined References (212)

PMID Year Title
27872486 2017 Alpha-2 macroglobulin in Alzheimer's disease: a marker of neuronal injury through the RCAN1 pathway.
27862254 2016 HK2 Proximal Tubule Epithelial Cells Synthesize and Secrete Plasma Proteins Predominantly Through the Apical Surface.
27839872 2016 Mutations in CPAMD8 Cause a Unique Form of Autosomal-Recessive Anterior Segment Dysgenesis.
27788907 2016 ?2-Macroglobulin: Autologous Protease Inhibition Technology.
27498393 2016 Quantitative proteomics revealed novel proteins associated with molecular subtypes of breast cancer.
27228572 2016 A proteomics analysis reveals that A2M might be regulated by STAT3 in persistent allergic rhinitis.
27090037 2016 Transcriptional expression profiles of the main proteinases and their regulators in coronary artery ectasia patients' mononuclear cells.
27044074 2016 BKCa channel regulates calcium oscillations induced by alpha-2-macroglobulin in human myometrial smooth muscle cells.
27031486 2016 Blood-Based Biomarker Candidates of Cerebral Amyloid Using PiB PET in Non-Demented Elderly.
27002159 2016 Activated ?2-Macroglobulin Regulates Transcriptional Activation of c-MYC Target Genes through Cell Surface GRP78 Protein.
26971636 2016 Combined biomarkers discriminate a low likelihood of bacterial infection among surgical intensive care unit patients with suspected sepsis.
26823978 2016 A panel of glycoproteins as candidate biomarkers for early diagnosis and treatment evaluation of B-cell acute lymphoblastic leukemia.
26688386 2016 Proteome profiles of HDL particles of patients with chronic heart failure are associated with immune response and also include bacteria proteins.
26385167 2015 Alpha-2-macroglobulin loaded microcapsules enhance human leukocyte functions and innate immune response.
26289409 2016 Pharmacogenetic Study on the Impact of Rivastigmine Concerning Genetic Variants of A2M and IL-6 Genes on Iranian Alzheimer's Patients.
26217017 2015 A Pro-Nerve Growth Factor (proNGF) and NGF Binding Protein, ?2-Macroglobulin, Differentially Regulates p75 and TrkA Receptors and Is Relevant to Neurodegeneration Ex Vivo and In Vivo.
26173077 2015 Laboratory markers predicting severity of acute pancreatitis.
26134405 2015 ?2-Macroglobulin Can Crosslink Multiple Plasmodium falciparum Erythrocyte Membrane Protein 1 (PfEMP1) Molecules and May Facilitate Adhesion of Parasitized Erythrocytes.
26103567 2015 Analysis of Alpha-2 Macroglobulin from the Long-Lived and Cancer-Resistant Naked Mole-Rat and Human Plasma.
25867373 2015 Upregulation of salivary ?2 macroglobulin in patients with type 2 diabetes mellitus.
25809189 2015 NR4A receptors up-regulate the antiproteinase alpha-2 macroglobulin (A2M) and modulate MMP-2 and MMP-9 in vascular smooth muscle cells.
25574746 2014 On the lack of a clear-cut association between alpha-2-macroglobulin deletion and the risk of Alzheimer disease in Poland.
25509857 [Biochip for determination of genetic markers of sporadic Alzheimer's disease in the Russian Slavic population].
25495992 2016 Association between two ?-2-macroglobulin gene polymorphisms and Parkinson's disease: a meta-analysis.
24799681 2014 Hypochlorite-induced structural modifications enhance the chaperone activity of human ?2-macroglobulin.
24756728 2014 Influence of Alpha-2-Macroglobulin 5 bp I/D and Ile1000Val polymorphisms on the susceptibility of Alzheimer's disease: a systematic review and meta-analysis of 52 studies.
24516643 2014 Activated ?2-macroglobulin binding to cell surface GRP78 induces T-loop phosphorylation of Akt1 by PDK1 in association with Raptor.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24093110 2013 Urinary IgG and ?2-macroglobulin are powerful predictors of outcome and responsiveness to steroids and cyclophosphamide in idiopathic focal segmental glomerulosclerosis with nephrotic syndrome.
24011543 2014 Association of cerebrospinal fluid A?42 with A2M gene in cognitively normal subjects.
23846698 2013 Hepcidin bound to ?2-macroglobulin reduces ferroportin-1 expression and enhances its activity at reducing serum iron levels.
23786280 2013 Eosinophil activation and novel mediators in the aspirin-induced nasal response in AERD.
23721263 2013 The monomeric receptor binding domain of tetrameric ?2-macroglobulin binds to cell surface GRP78 triggering equivalent activation of signaling cascades.
23643808 2013 Alteration of prolyl oligopeptidase and activated ?-2-macroglobulin in multiple sclerosis subtypes and in the clinically isolated syndrome.
23535567 2013 Serum monomeric ?2-macroglobulin as a clinical biomarker in diabetes.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23397525 2013 Interaction of insulin-like growth factor-binding protein 2 with ?2-macroglobulin in the circulation.
23379699 2013 ?2-Macroglobulin enhances vasculogenesis/angiogenesis of mouse embryonic stem cells by stimulation of nitric oxide generation and induction of fibroblast growth factor-2 expression.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23353684 2013 Protease-activated alpha-2-macroglobulin can inhibit amyloid formation via two distinct mechanisms.
23186781 2013 Association of polymorphisms in the LRP1 and A2M genes with Alzheimer's disease in the northern Chinese Han population.
23089609 2012 Inhibition of Aeromonas sobria serine protease (ASP) by ?2-macroglobulin.
23086799 2013 ?-2-Macroglobulin: a physiological guardian.
23064953 2012 Novel aspects of urokinase function in the injured lung: role of ?2-macroglobulin.
22971340 2012 The tail nick augments Aeromonas sobria serine protease (ASP) activity in plasma through retarding inhibition by ?2-macroglobulin.
22576683 2012 Clinicopathological characteristics of androgen-dependent advanced prostate cancer patients with ?2-macroglobulin deficiency.
22541546 2012 Expression, purification and structural analysis of recombinant rBdh-2His?, a spermadhesin from buck (Capra hircus) seminal plasma.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
21971609 2011 Diagnostic value of multiple biomarker panel for prediction of significant fibrosis in chronic hepatitis C.
21642630 2011 During glaucoma, alpha2-macroglobulin accumulates in aqueous humor and binds to nerve growth factor, neutralizing neuroprotection.
21541797 2011 Characterization of a novel positive transcription regulatory element that differentially regulates the alpha-2-macroglobulin gene in replicative senescence.
21362503 2011 Protein profile of exosomes from trabecular meshwork cells.
21269460 2011 Initial characterization of the human central proteome.
21216953 2011 Inhibition of beta2-microglobulin amyloid fibril formation by alpha2-macroglobulin.
20861575 2010 Exploration of genetic susceptibility factors for Parkinson's disease in a South American sample.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20637261 2010 Lack of interaction between LRP1 and A2M polymorphisms for the risk of Alzheimer disease.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20587546 2010 Interferon gamma receptor 2 gene variants are associated with liver fibrosis in patients with chronic hepatitis C infection.
20575108 2010 Application of champedak mannose-binding lectin in the glycoproteomic profiling of serum samples unmasks reduced expression of alpha-2 macroglobulin and complement factor B in patients with nasopharyngeal carcinoma.
20493925 2010 Association between haplotype -88G/25G in A2M with Alzheimer's disease.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20401725 2011 Association analysis of TNFR2, VDR, A2M, GSTT1, GSTM1, and ACE genes with rheumatoid arthritis in South Asians and Caucasians of East Midlands in the United Kingdom.
20381197 2011 ACE variants and risk of intracerebral hemorrhage recurrence in amyloid angiopathy.
20207732 2010 Surfactant protein D interacts with alpha2-macroglobulin and increases its innate immune potential.
20156641 2010 Proteomics of microparticles after deep venous thrombosis.
20048078 2010 Alpha2-macroglobulin inhibits the malignant properties of astrocytoma cells by impeding beta-catenin signaling.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19639019 2010 Depletion of potential A2M risk haplotype for Alzheimer's disease in long-lived individuals.
19472074 2010 Extracellular chaperones modulate the effects of Alzheimer's patient cerebrospinal fluid on Abeta(1-42) toxicity and uptake.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
19105203 2009 An association analysis of Alzheimer disease candidate genes detects an ancestral risk haplotype clade in ACE and putative multilocus association between ACE, A2M, and LRRTM3.
19074141 2009 alpha2-Macroglobulin and haptoglobin suppress amyloid formation by interacting with prefibrillar protein species.
18706476 2008 Genetic association between low-density lipoprotein receptor-related protein gene polymorphisms and Alzheimer's disease in Chinese Han population.
18579803 2008 Copper is taken up efficiently from albumin and alpha2-macroglobulin by cultured human cells by more than one mechanism.
18499670 2008 Molecular dissection of the human alpha2-macroglobulin subunit reveals domains with antagonistic activities in cell signaling.
18485748 2008 Inhibition of ADAMTS-7 and ADAMTS-12 degradation of cartilage oligomeric matrix protein by alpha-2-macroglobulin.
18382889 2008 Senile systemic amyloidosis affects 25% of the very aged and associates with genetic variation in alpha2-macroglobulin and tau: a population-based autopsy study.
18191876 2009 Alpha-2-macroglobulin gene, oxidized low-density lipoprotein receptor-1 locus, and sporadic Alzheimer's disease.
18171086 2008 Protease activation of alpha2-macroglobulin modulates a chaperone-like action with broad specificity.
18164103 2008 Interactions between the products of the Herpes simplex genome and Alzheimer's disease susceptibility genes: relevance to pathological-signalling cascades.
18077315 2008 Is alpha2-macroglobulin important in female stress urinary incontinence?
18075673 2008 Potential roles of abundant extracellular chaperones in the control of amyloid formation and toxicity.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17967834 2008 Alpha 2-macroglobulin binds CpG oligodeoxynucleotides and enhances their immunostimulatory properties by a receptor-dependent mechanism.
17851198 2007 Zinc dyshomeostasis, ageing and neurodegeneration: implications of A2M and inflammatory gene polymorphisms.
17608619 2007 Human alpha2-macroglobulin is composed of multiple domains, as predicted by homology with complement component C3.
17453620 2007 Alpha2-macroglobulin is a potential facilitator of prion protein transformation.
17403113 2007 Role of elevated alpha2-macroglobulin revisited: results of a case-control study in children with symptomatic thromboembolism.
17288987 2007 Activated alpha(2)-macroglobulin induces cell proliferation and mitogen-activated protein kinase activation by LRP-1 in the J774 macrophage-derived cell line.
17071617 2006 Inhibition of bone morphogenetic protein 1 by native and altered forms of alpha2-macroglobulin.
16910174 The genetic association between alpha-2-macroglobulin (A2M) gene deletion polymorphism and low serum A2M concentration in overweight/obese Thais.
16784755 2006 Interaction of CTSD and A2M polymorphisms in the risk for Alzheimer's disease.
16650578 2006 Alpha2-macroglobulin, lipoprotein receptor-related protein and lipoprotein receptor-associated protein and the genetic risk for developing Alzheimer's disease.
16641085 2006 Limited mutations in full-length tetrameric human alpha2-macroglobulin abrogate binding of platelet-derived growth factor-BB and transforming growth factor-beta1.
16541075 2006 The finished DNA sequence of human chromosome 12.
16456795 2006 [Association of the polymorphism in alpha-2 macroglobulin gene with essential tremor and Parkinson's disease].
16407218 2006 Interaction of mannan binding lectin with alpha2 macroglobulin via exposed oligomannose glycans: a conserved feature of the thiol ester protein family?
16402284 2006 Longitudinal memory performance during normal aging: twin association models of APOE and other Alzheimer candidate genes.
16384981 2006 Functional candidate genes in age-related macular degeneration: significant association with VEGF, VLDLR, and LRP6.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16297527 2005 Functions of alpha 2 macroglobulins in pregnancy.
16232083 2005 Structural evaluation of plasma alpha2-macroglobulin in acute pancreatitis.
16040006 2005 Association study of the A2M and LRP1 Genes with Alzheimer disease in the Han Chinese.
15931081 2005 Genetic studies of A2M and BACE1 genes in Chinese Han Alzheimer's disease patients.
15910735 2005 Mutation of lysine 1370 in full-length human alpha2-macroglobulin blocks binding to the low density lipoprotein receptor-related protein-1.
15908432 2005 Binding of activated alpha2-macroglobulin to its cell surface receptor GRP78 in 1-LN prostate cancer cells regulates PAK-2-dependent activation of LIMK.
15793779 2005 [No evidence for genetic association between alpha-2 macroglobulin I1000V polymorphism and sporadic Alzheimer's disease in two independent Chinese populations].
15611997 2005 Alpha(2) macroglobulin, a PSA binding protein, is expressed in human prostate stroma.
15584876 2004 Genomic characterization of Alzheimer's disease and genotype-related phenotypic analysis of biological markers in dementia.
15511627 2004 Significantly increased fractions of transformed to total alpha2-macroglobulin concentrations in plasma from patients with multiple sclerosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15468911 2004 Neither the tumor necrosis factor alpha-308 A/G polymorphism nor the alpha2-macroglobulin polymorphism was associated with late-onset Alzheimer's disease in the Chinese population.
15226301 2004 Identification and characterization of the acidic pH binding sites for growth regulatory ligands of low density lipoprotein receptor-related protein-1.
15023809 2004 Increased risk for Alzheimer disease with the interaction of MPO and A2M polymorphisms.
14760718 2004 Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.
14759632 2004 Angiotensin-converting enzyme and alpha-2-macroglobulin gene polymorphisms are not associated with Alzheimer's disease in Colombian patients.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14715656 2004 Alpha2-macroglobulin is a novel substrate for ADAMTS-4 and ADAMTS-5 and represents an endogenous inhibitor of these enzymes.
14687906 2004 Complex formation between human kallikrein 13 and serum protease inhibitors.
14678766 2003 Functional analysis of plasma alpha(2)-macroglobulin from Alzheimer's disease patients with the A2M intronic deletion.
14675603 2004 Association of alpha 2-macroglobulin polymorphisms and Alzheimer disease in Mainland Han Chinese.
14637088 2003 Human alpha2-macroglobulin: genotype-phenotype relation.
14506912 2003 Inhibition of human pepsin and gastricsin by alpha2-macroglobulin.
12966032 2003 Genetic association of Alzheimer's disease with multiple polymorphisms in alpha-2-macroglobulin.
12782964 2003 Joint analysis of candidate genes related to Alzheimer's disease in a Spanish population.
12782337 2003 Simultaneous analysis of five genetic risk factors in Polish patients with Alzheimer's disease.
12755687 2003 Characterization of the interaction between alpha2-macroglobulin and fibroblast growth factor-2: the role of hydrophobic interactions.
12755614 2003 Growth factor-binding sequence in human alpha2-macroglobulin targets the receptor-binding site in transforming growth factor-beta.
12754519 2003 Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.
12631277 2003 Disruption of structural and functional integrity of alpha 2-macroglobulin by cathepsin E.
12538697 2003 Natural substrates and inhibitors of mannan-binding lectin-associated serine protease-1 and -2: a study on recombinant catalytic fragments.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12394648 2002 Variation in the lipoprotein receptor-related protein, alpha2-macroglobulin and lipoprotein receptor-associated protein genes in relation to plasma lipid levels and risk of early myocardial infarction.
12221172 2002 Genetic association of alpha2-macroglobulin polymorphisms with AD in southern Italy.
12194978 2002 The role of Grp 78 in alpha 2-macroglobulin-induced signal transduction. Evidence from RNA interference that the low density lipoprotein receptor-related protein is associated with, but not necessary for, GRP 78-mediated signal transduction.
12175343 2002 Genetic association of argyrophilic grain disease with polymorphisms in alpha-2 macroglobulin and low-density lipoprotein receptor-related protein genes.
12123860 2002 No evidence of association between the alpha-2 macroglobulin gene and Parkinson's disease in a case-control sample.
12062545 2002 Alpha 2-macroglobulin enhances prothrombin activation and thrombin potential by inhibiting the anticoagulant protein C/protein S system in cord and adult plasma.
12059070 2002 Alpha2-macroglobulin deletion polymorphism and plasma levels in late onset Alzheimer's disease.
12042276 2002 Ovarian hyperstimulation syndrome and assisted reproductive technologies: why some and not others?
12015318 2002 The three-dimensional structure of the human alpha 2-macroglobulin dimer reveals its structural organization in the tetrameric native and chymotrypsin alpha 2-macroglobulin complexes.
11987698 [Alpha2-macroglobulin gene polymorphism in patients with Alzheimer's disease].
11916201 2002 Relevance of variants in serum antiproteinases for the course of chronic pancreatitis.
11910179 Alfimeprase: pharmacology of a novel fibrinolytic metalloproteinase for thrombolysis.
11823454 2002 Distinct binding sites in the structure of alpha 2-macroglobulin mediate the interaction with beta-amyloid peptide and growth factors.
11811950 2002 Differential binding properties of human pregnancy zone protein- and alpha2-macroglobulin-proteinase complexes to low-density lipoprotein receptor-related protein.
11498265 2001 No association of three polymorphisms in the alpha-2-macroglobulin and lipoprotein related receptor genes with multiple sclerosis.
11496365 2001 Common polymorphisms in LRP and A2M do not affect genetic risk for Alzheimer disease in Northern Ireland.
11484172 2001 [No evidence for association between the alpha 2-macroglobulin polymorphism and Alzheimer's disease in the Han Chinese].
11455130 Analysis of alpha-2-macroglobulin-2 allele as a risk factor in Alzheimer's disease.
11436125 2001 Lack of replication of association findings in complex disease: an analysis of 15 polymorphisms in prior candidate genes for sporadic Alzheimer's disease.
11435418 2001 Interaction of lecithin:cholesterol acyltransferase (LCAT).alpha 2-macroglobulin complex with low density lipoprotein receptor-related protein (LRP). Evidence for an alpha 2-macroglobulin/LRP receptor-mediated system participating in LCAT clearance.
11290389 2001 Alpha-1 antichymotrypsin and alpha-2 macroglobulin gene polymorphisms are not associated with Korean late-onset Alzheimer's disease.
11281447 2001 Lack of association between alpha2-macroglobulin polymorphisms and Alzheimer's disease.
11231028 2001 Association of alpha-2-macroglobulin deletion polymorphism with sporadic Alzheimer's disease in Koreans.
11166925 2001 Alpha2-macroglobulin polymorphisms in Italian sporadic and familial Alzheimer's disease.
11162584 2001 Expression and enzymatic activity of human disintegrin and metalloproteinase ADAM19/meltrin beta.
11122949 2000 The genetics of Alzheimer's disease.
11121179 2000 Identical distribution of the alpha 2-macroglobulin pentanucleotide deletion in subjects with Alzheimer disease and controls in a German population.
11100124 2000 Uptake of HIV-1 tat protein mediated by low-density lipoprotein receptor-related protein disrupts the neuronal metabolic balance of the receptor ligands.
11099722 2000 Genetic risk factors of sporadic Alzheimer's disease among Chinese in Taiwan.
11097334 2000 Hunting for disease genes in multi-functional diseases.
11058789 2000 Polymorphisms in the alpha-2 macroglobulin gene in psychogeriatric patients.
11036822 2000 A DNA polymorphism at the alpha2-macroglobulin gene is associated with the severity of rheumatoid arthritis.
11023837 2000 alpha2-macroglobulin modulates the immunoregulatory function of the lipocalin placental protein 14.
10959035 2000 alpha2-macroglobulin in late-onset Alzheimer's disease.
10880251 2000 Involvement of alpha-2-macroglobulin receptor in clearance of interleukin 8-alpha-2-macroglobulin complexes by human alveolar macrophages.
10815129 2000 Role of the low-density lipoprotein receptor-related protein in beta-amyloid metabolism and Alzheimer disease.
10731476 2000 alpha2-Macroglobulin, the main serum antiprotease, binds beta2-microglobulin, the light chain of the class I major histocompatibility complex, which is involved in human disease.
10714547 2000 Interleukin-4 and IL-10 bind covalently to activated human alpha2-macroglobulin by a mechanism that requires Cys949.
10652313 2000 NMR solution structure of complement-like repeat CR3 from the low density lipoprotein receptor-related protein. Evidence for specific binding to the receptor binding domain of human alpha(2)-macroglobulin.
10373500 1999 ADAMTS-1 is an active metalloproteinase associated with the extracellular matrix.
9865955 1998 Localization of basic residues required for receptor binding to the single alpha-helix of the receptor binding domain of human alpha2-macroglobulin.
9831625 1998 Association of apolipoprotein E with alpha2-macroglobulin in human plasma.
9724081 1998 Human leptin forms complexes with alpha 2-macroglobulin which are recognized by the alpha 2-macroglobulin receptor/low density lipoprotein receptor-related protein.
9714181 1998 A modified human alpha 2-macroglobulin derivative that binds tumor necrosis factor-alpha and interleukin-1 beta with high affinity in vitro and reverses lipopolysaccharide toxicity in vivo in mice.
9697696 1998 Alpha-2 macroglobulin is genetically associated with Alzheimer disease.
9398211 1997 Human alpha 2-macroglobulin is an osteogenic growth peptide-binding protein.
9344465 1997 Interaction of matrix metalloproteinases-2 and -9 with pregnancy zone protein and alpha2-macroglobulin.
9166830 1997 The inv(11)(p15q22) chromosome translocation of de novo and therapy-related myeloid malignancies results in fusion of the nucleoporin gene, NUP98, with the putative RNA helicase gene, DDX10.
8583572 1996 Complex formation between PSA isoenzymes and protease inhibitors.
7680268 1993 Mannose-specific lectins bind alpha-2-macroglobulin and an unknown protein from human plasma.
7533769 1995 Alpha 2-macroglobulin production by the human endometrium.
7533162 1995 alpha 1-Microglobulin destroys the proteinase inhibitory activity of alpha 1-inhibitor-3 by complex formation.
7519849 1994 Isolation and characterization of fibronectin-alpha 1-microglobulin complex in rat plasma.
6698368 1984 Mesotrypsin: a new inhibitor-resistant protease from a zymogen in human pancreatic tissue and fluid.
6203908 1984 Primary structure of human alpha 2-macroglobulin. V. The complete structure.
6195065 1983 Human neutrophil elastase and cathepsin G cleavage sites in the bait region of alpha 2-macroglobulin. Proposed structural limits of the bait region.
6191979 1983 Radioimmunoassay of human pancreatic elastase 1. In vitro interaction of human pancreatic elastase 1 with serum protease inhibitors.
6172288 1981 Primary and secondary cleavage sites in the bait region of alpha 2-macroglobulin.
6167263 1981 Proteolytic cleavage sites on alpha 2-macroglobulin resulting in proteinase binding are different for trypsin and Staphylococcus aureus V-8 proteinase.
6165619 1981 Primary structure of the 'bait' region for proteinases in alpha 2-macroglobulin. Nature of the complex.
6153632 1980 Interaction between human pancreatic elastase and plasma protease inhibitors.
3289986 1988 Synthesis and localization of plasma proteins in the developing human brain. Integrity of the fetal blood-brain barrier to endogenous proteins of hepatic origin.
2581245 1985 Nucleotide sequence of cDNA encoding human alpha 2-macroglobulin and assignment of the chromosomal locus.
2476070 1989 Interaction of lysosomal cysteine proteinases with alpha 2-macroglobulin: conclusive evidence for the endopeptidase activities of cathepsins B and H.
2460294 1988 The polymorphic human alpha 2-macroglobulin gene (A2M) is located in chromosome region 12p12.3----p13.3.
2459995 1988 [Comparison of protein concentrations in saliva and serum].
2430963 1986 Primary structure of human alpha 2-macroglobulin. Complete disulfide bridge assignment and localization of two interchain bridges in the dimeric proteinase binding unit.
2408344 1985 Human alpha 2-macroglobulin gene is located on chromosome 12.
1707161 1991 Sequence polymorphism in the human alpha-2-macroglobulin (A2M) gene.
1697852 1990 Isolation of rat serum alpha 1-microglobulin. Identification of a complex with alpha 1-inhibitor-3, a rat alpha 2-macroglobulin homologue.
1692292 1990 A genetic polymorphism in a functional domain of human pregnancy zone protein: the bait region. Genomic structure of the bait domains of human pregnancy zone protein and alpha 2 macroglobulin.
1374237 1992 Structure of the human alpha-2 macroglobulin gene and its promotor.
1370808 1992 Cloning of the human alpha 2-macroglobulin gene and detection of mutations in two functional domains: the bait region and the thiolester site.
1281457 1992 Alpha 2-macroglobulin, a multifunctional binding protein with targeting characteristics.
89758 [Uniform method for determining the alpha 1-antitrypsin and alpha 2-macroglobulin activity in human blood serum (plasma)].
59727 1976 Platelet alpha2-macroglobulin and alpha1-antitrypsin.