Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.92
PubTator Score 4.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Myopathies, Structural, Congenital 15 0.0 0.0
Disease Target Count Z-score Confidence
Centronuclear myopathy 27 0.0 5.0
Disease Target Count Z-score Confidence
Congenital myopathy 16 4.837 2.4
Disease Target Count
MYOPATHY, CENTRONUCLEAR, 4 1

Expression

  Differential Expression (4)

Disease log2 FC p
invasive ductal carcinoma 1.300 1.2e-02
nasopharyngeal carcinoma -1.400 7.2e-06
osteosarcoma -1.756 2.1e-06
posterior fossa group B ependymoma 2.100 7.8e-05

Gene RIF (2)

AA Sequence

MEHAATTGPRPGPPSRRVENVVLRAKDWLPGAPGGTAVWATSLEAEVPPDLALNKEQQLQISKELVDIQI      1 - 70
TTHHLHEQHEAEIFQLKSEILRLESRVLELELRGDGTSQGCAVPVESDPRHPRAAAQELRHKAQVPGHSD     71 - 140
DHRFQVQPKNTMNPENEQHRLGSGLQGEVKWALEHQEARQQALVTRVATLGRQLQGAREEARAAGQRLAT    141 - 210
QAVVLCSCQGQLRQAEAENARLQLQLKKLKDEYVLRLQHCAWQAVEHADGAGQAPATTALRTFLEATLED    211 - 280
IRAAHRSREQQLARAARSYHKRLVDLSRRHEELLVAYRAPGNPQAIFDIASLDLEPLPVPLVTDFSHRED    281 - 350
QHGGPGALLSSPKKRPGGASQGGTSEPQGLDAASWAQIHQKLRDFSRSTQSWNGSGHSCWSGPRWLKSNF    351 - 420
LSYRSTWTSTWAGTSTKS                                                        421 - 438
//

Text Mined References (9)

PMID Year Title