Property Summary

NCBI Gene PubMed Count 6
PubMed Score 5.88
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
breast carcinoma 1638 3.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Synonym

Accession A2A3N6 Q6NUK8 PIP5K1A-PSMD4
Symbols PSMD4P2
PIP5K1L1
PIP5K1P3
bA429H9.1

Gene

PANTHER Protein Class (2)

Gene RIF (2)

AA Sequence

MASEVPYASGMPIKKIGHRSVDSSGGTTSSALKGAIQLGITHTVGSLSTKPESDVLMQDFHMVESIFFPS      1 - 70
EGSNLTPAHHYNAFRFKTYAPVAFRYFWELFGIRPDDYLYSLCSEPLIELCSSGASGSLFYVSSDDEFIV     71 - 140
KTVRHKEAEFLQKLLPGYYINLNQNPRTLLPKFYGLYCVQTGGKNIRIVVMNNLLPRSVKMHIKYDLKGS    141 - 210
TYRRRASQKEREKPLPTFKDLDFLQDIPDGLFLDADVHNALCKTLQRDCLVLQSFKIMDYSLLMSIHNID    211 - 280
HAQREPLSSETQYSVDTRRPAPQKALYSTAMESIQGEARRGGTMETDDHMGGIPARNSKGERLLLYIGII    281 - 350
DILQSYRFVKKLEHSWKALIHDGDTVSVHRPGFYAEWFQRFMCNTVFKKIPLKPSPSKKLRSGSSFSQRA    351 - 420
GSSGNSCITYQPLVSGEHKAQVTTKAEVEPGVHLGCPDVLPQTPPLEEISEGSPTPDPSFSPLVEETLQM    421 - 490
LTTSVDNSEYMGNGDFLPTRLQAQQDAVNTVCHSKTRSNPENNVGLITLDNDCEVLTTLTPDTGRILSKL    491 - 560
HTVQPKGKITFCMGIHVAHLALKHRQGNNHKIRIIAFVGNPVEDNEKNLVKLAKCLKKEKVNVDIINFGE    561 - 630
EEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISFPILAGEGGAMMGLGASDFEFGVDPSADPE    631 - 700
LALVLRVFMEEQRQRQEEEARQAAAASAAEAGIATTGTEDSDDALLKMTISQQEFGHTGLPDLSSMTEEE    701 - 770
KIVCAMQMSLQGAEFGLAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNA    771 - 840
VGSLASQATKDSKKDKKEEDKK                                                    841 - 862
//

Text Mined References (6)

PMID Year Title