Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.98
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
breast carcinoma 1,614

Synonym

Accession A2A3N6 Q6NUK8 PIP5K1A-PSMD4
Symbols PSMD4P2
PIP5K1L1
PIP5K1P3
bA429H9.1

Gene

PANTHER Protein Class (2)

 GO Component (1)

Gene RIF (2)

PMID Text
20525901 The first evidence for the translation of PIPSL in humans, is provided.
17623810 PIPSL is a tightly regulated, testis-specific novel ubiquitin-binding protein formed by an unusual exon-shuffling mechanism in hominoid primates and represents a key example of rapid evolution of a testis-specific gene.

AA Sequence

MASEVPYASGMPIKKIGHRSVDSSGGTTSSALKGAIQLGITHTVGSLSTKPESDVLMQDFHMVESIFFPS      1 - 70
EGSNLTPAHHYNAFRFKTYAPVAFRYFWELFGIRPDDYLYSLCSEPLIELCSSGASGSLFYVSSDDEFIV     71 - 140
KTVRHKEAEFLQKLLPGYYINLNQNPRTLLPKFYGLYCVQTGGKNIRIVVMNNLLPRSVKMHIKYDLKGS    141 - 210
TYRRRASQKEREKPLPTFKDLDFLQDIPDGLFLDADVHNALCKTLQRDCLVLQSFKIMDYSLLMSIHNID    211 - 280
HAQREPLSSETQYSVDTRRPAPQKALYSTAMESIQGEARRGGTMETDDHMGGIPARNSKGERLLLYIGII    281 - 350
DILQSYRFVKKLEHSWKALIHDGDTVSVHRPGFYAEWFQRFMCNTVFKKIPLKPSPSKKLRSGSSFSQRA    351 - 420
GSSGNSCITYQPLVSGEHKAQVTTKAEVEPGVHLGCPDVLPQTPPLEEISEGSPTPDPSFSPLVEETLQM    421 - 490
LTTSVDNSEYMGNGDFLPTRLQAQQDAVNTVCHSKTRSNPENNVGLITLDNDCEVLTTLTPDTGRILSKL    491 - 560
HTVQPKGKITFCMGIHVAHLALKHRQGNNHKIRIIAFVGNPVEDNEKNLVKLAKCLKKEKVNVDIINFGE    561 - 630
EEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISFPILAGEGGAMMGLGASDFEFGVDPSADPE    631 - 700
LALVLRVFMEEQRQRQEEEARQAAAASAAEAGIATTGTEDSDDALLKMTISQQEFGHTGLPDLSSMTEEE    701 - 770
KIVCAMQMSLQGAEFGLAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNA    771 - 840
VGSLASQATKDSKKDKKEEDKK                                                    841 - 862
//

Text Mined References (6)

PMID Year Title
20525901 2010 Inference for the initial stage of domain shuffling: tracing the evolutionary fate of the PIPSL retrogene in hominoids.
17623810 2007 A novel testis ubiquitin-binding protein gene arose by exon shuffling in hominoids.
16344562 2006 Transcription-mediated gene fusion in the human genome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.