Property Summary

NCBI Gene PubMed Count 1
PubMed Score 1.33
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.700 0.000

AA Sequence

MSSPNPEDVPRRPEPEPSSSNKKKKKRKWLRQEASIQALTRAGHGALQAGQNHEALNNFQRAFLLASKAP      1 - 70
QTRDTPVLQACAFNLGAAYVETGDPARGLELLLRAHPEEKAQGRRHGDQCFNVALAYHALGELPQALAWY     71 - 140
HRALGHYQPQGDQGEAWAKMGACYQALGQPELAAHCLQEASQAYAQERQLRAAALALGAAAGCMLKSGRH    141 - 210
RVGEVVQVLEKSRRLAERSTERRLLGHLYNDLGLGYSQLQLFPLAVEAFLQALPLCWVPGEQATVLRNLG    211 - 280
MAHNALGNYQEAREFHQKAADLHGSVGQRWEQGRSFGSLAFALSQLGDHKAARDNYLHALQAARDSGDMK    281 - 350
GQWQACEGLGAAAARLGQYDQALKYYKEALAQCQKEPDSVRERLVAKLADTVRTRLAQVGLVQTHTLTSA    351 - 420
PGRLQAPGGASQAEGTPAKAGSSTAGVQHRSSSGWEDEEFEEGHQKKKEERSANVPVRAGPGRPELCFLP    421 - 490
GTVNHSHHLASSCPTFTKHTPCRGTVLGKASIYSPGPRAHLPFVGPGPPRAEYPSILVPNGPQANRSSRW    491 - 560
PRESLSRSRQRRPMESGICTIV                                                    561 - 582
//

Text Mined References (2)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
11181995 2001 The sequence of the human genome.