Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.21
PubTator Score 0.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.100 5.2e-03
astrocytic glioma -1.500 5.4e-03
group 4 medulloblastoma -1.200 4.3e-03
medulloblastoma, large-cell -1.300 3.5e-04
oligodendroglioma -1.400 7.3e-03
osteosarcoma 2.272 2.0e-04
ovarian cancer 1.200 3.0e-04
pancreatic ductal adenocarcinoma liver m... 1.200 3.7e-03
Pick disease -1.200 5.0e-04
progressive supranuclear palsy -1.100 3.4e-02

Protein-protein Interaction (6)

AA Sequence

MAAGVLPQNEQPYSTLVNNSECVANMKGNLERPTPKYTKVGERLRHVIPGHMACSMACGGRACKYENPAR      1 - 70
WSEQEQAIKGVYSSWVTDNILAMARPSSELLEKYHIIDQFLSHGIKTIINLQRPGEHASCGNPLEQESGF     71 - 140
TYLPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIACYLVFATR    141 - 210
MTADQAIIFVRAKRPNSIQTRGQLLCVREFTQFLTPLRNIFSCCDPKAHAVTLPQYLIRQRHLLHGYEAR    211 - 280
LLKHVPKIIHLVCKLLLDLAENRPVMMKDVSEGPGLSAEIEKTMSEMVTMQLDKELLRHDSDVSNPPNPT    281 - 350
AVAADFDNRGMIFSNEQQFDPLWKRRNVECLQPLTHLKRRLSYSDSDLKRAENLLEQGETPQTVPAQILV    351 - 420
GHKPRQQKLISHCYIPQSPEPDLHKEALVRSTLSFWSQSKFGGLEGLKDNGSPIFHGRIIPKEAQQSGAF    421 - 490
SADVSGSHSPGEPVSPSFANVHKDPNPAHQQVSHCQCKTHGVGSPGSVRQNSRTPRSPLDCGSSPKAQFL    491 - 560
VEHETQDSKDLSEAASHSALQSELSAEARRILAAKALANLNESVEKEELKRKVEMWQKELNSRDGAWERI    561 - 630
CGERDPFILCSLMWSWVEQLKEPVITKEDVDMLVDRRADAAEALFLLEKGQHQTILCVLHCIVNLQTIPV    631 - 700
DVEEAFLAHAIKAFTKVNFDSENGPTVYNTLKKIFKHTLEEKRKMTKDGPKPGL                    701 - 754
//

Text Mined References (8)

PMID Year Title