Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.29
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MSQDQESPRCTHDQHLQTFSETQSLEVAQVSKALEKTLLSSSHPLVPGKLKEAPAAKAESPLEVPQSFCS      1 - 70
SSIAVTTTSSSESDEASSNQEEEDSPSSSEDTSDPRNVPADALDQKVAFLVNFMLHKCQMKKPITKADML     71 - 140
KIIIKDDESHFSEILLRASEHLEMIFGLDVVEVDPTTHCYGLFIKLGLTYDGMLSGEKGVPKTGLLIIVL    141 - 210
GVIFMKGNRATEEEVWEVLNLTGVYSGKKHFIFGEPRMLITKDFVKEKYLEYQQVANSDPARYEFLWGPR    211 - 280
AKAETSKMKVLEFVAKVHGSYPHSFPSQYAEALKEEEERARARI                              281 - 324
//

Text Mined References (3)

PMID Year Title