Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.27
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Synonym

Accession A2A368 A8MU30
Symbols

Gene

PANTHER Protein Class (1)

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
24219866 The testis-specific expression of MAGEB16 and Mageb16 is regulated by the methylation status of their promoter regions.

AA Sequence

MSQDQESPRCTHDQHLQTFSETQSLEVAQVSKALEKTLLSSSHPLVPGKLKEAPAAKAESPLEVPQSFCS      1 - 70
SSIAVTTTSSSESDEASSNQEEEDSPSSSEDTSDPRNVPADALDQKVAFLVNFMLHKCQMKKPITKADML     71 - 140
KIIIKDDESHFSEILLRASEHLEMIFGLDVVEVDPTTHCYGLFIKLGLTYDGMLSGEKGVPKTGLLIIVL    141 - 210
GVIFMKGNRATEEEVWEVLNLTGVYSGKKHFIFGEPRMLITKDFVKEKYLEYQQVANSDPARYEFLWGPR    211 - 280
AKAETSKMKVLEFVAKVHGSYPHSFPSQYAEALKEEEERARARI                              281 - 324
//

Text Mined References (3)

PMID Year Title
24219866 2014 Demethylation of CpG islands in the 5' upstream regions mediates the expression of the human testis-specific gene MAGEB16 and its mouse homolog Mageb16.
15772651 2005 The DNA sequence of the human X chromosome.
11454705 2001 An overview of the MAGE gene family with the identification of all human members of the family.