Property Summary

NCBI Gene PubMed Count 11
PubMed Score 17.31
PubTator Score 18.45

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (17)

Disease log2 FC p
acute quadriplegic myopathy -1.802 1.6e-07
adrenocortical carcinoma -1.192 4.0e-04
cystic fibrosis -1.100 8.7e-04
Duchenne muscular dystrophy -1.149 5.4e-08
ductal carcinoma in situ -1.400 9.7e-05
group 4 medulloblastoma -1.400 2.1e-03
invasive ductal carcinoma -1.204 1.6e-03
lung adenocarcinoma -1.600 1.1e-15
non-small cell lung cancer -1.595 9.3e-20
osteosarcoma -2.222 1.6e-03
ovarian cancer -1.500 4.2e-02
pancreatic cancer 1.700 1.5e-03
pancreatic carcinoma 1.700 1.5e-03
psoriasis -1.100 1.9e-17
Rheumatoid arthritis 2.000 9.2e-03
subependymal giant cell astrocytoma 1.510 1.9e-02
tuberculosis 1.600 2.0e-05

Gene RIF (7)

AA Sequence

MFASCHCVPRGRRTMKMIHFRSSSVKSLSQEMRCTIRLLDDSEISCHIQRETKGQFLIDHICNYYSLLEK      1 - 70
DYFGIRYVDPEKQRHWLEPNKSIFKQMKTHPPYTMCFRVKFYPHEPLKIKEELTRYLLYLQIKRDIFHGR     71 - 140
LLCSFSDAAYLGACIVQAELGDYDPDEHPENYISEFEIFPKQSQKLERKIVEIHKNELRGQSPPVAEFNL    141 - 210
LLKAHTLETYGVDPHPCKDSTGTTTFLGFTAAGFVVFQGNKRIHLIKWPDVCKLKFEGKTFYVIGTQKEK    211 - 280
KAMLAFHTSTPAACKHLWKCGVENQAFYKYAKSSQIKTVSSSKIFFKGSRFRYSGKVAKEVVEASSKIQR    281 - 350
EPPEVHRANITQSRSSHSLNKQLIINMEPLQPLLPSPSEQEEELPLGEGVPLPKEENISAPLISSSPVKA    351 - 420
AREYEDPPSEEEDKIKEEPLTISELVYNPSASLLPTPVDDDEIDMLFDCPSRLELEREDTDSFEDLEADE    421 - 490
NAFLIAEEEELKEARRALSWSYDILTGHIRVNPLVKSFSRLLVVGLGLLLFVFPLLLLLLESGIDLSFLC    491 - 560
EIRQTPEFEQFHYEYYCPLKEWVAGKVHLILYMLGCS                                     561 - 597
//

Text Mined References (14)

PMID Year Title