Property Summary

NCBI Gene PubMed Count 11
PubMed Score 16.85
PubTator Score 18.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Chloracne 32
Disease Target Count P-value
non-small cell lung cancer 2798 1.13686693167377E-25
lung adenocarcinoma 2714 3.43897792094062E-24
Duchenne muscular dystrophy 602 5.39540688528132E-8
acute quadriplegic myopathy 1157 1.55095815608029E-7
psoriasis 6685 3.86228710679422E-7
tuberculosis 1563 1.95226894784199E-5
invasive ductal carcinoma 2950 1.0470120298677E-4
ductal carcinoma in situ 1745 1.27583087788216E-4
cystic fibrosis 1670 8.71583187365972E-4
pancreatic carcinoma 567 0.00145779738182505
pancreatic cancer 2300 0.00145779738182507
osteosarcoma 7933 0.00162992842019431
group 4 medulloblastoma 1875 0.0021264405666296
adrenocortical carcinoma 1427 0.00285351414319312
Rheumatoid Arthritis 1171 0.00923271861606975
subependymal giant cell astrocytoma 2287 0.0149678056427302
ovarian cancer 8492 0.0419668101336929

Expression

  Differential Expression (17)

Disease log2 FC p
Rheumatoid Arthritis 2.000 0.009
pancreatic cancer 1.700 0.001
osteosarcoma -2.222 0.002
Duchenne muscular dystrophy -1.149 0.000
acute quadriplegic myopathy -1.802 0.000
adrenocortical carcinoma -1.572 0.003
tuberculosis 1.600 0.000
non-small cell lung cancer -2.630 0.000
cystic fibrosis -1.100 0.001
lung adenocarcinoma -1.700 0.000
group 4 medulloblastoma -1.400 0.002
pancreatic carcinoma 1.700 0.001
psoriasis -1.200 0.000
subependymal giant cell astrocytoma 2.336 0.015
invasive ductal carcinoma -2.400 0.000
ductal carcinoma in situ -1.600 0.000
ovarian cancer -1.500 0.042

Synonym

Accession A2A2Y4 A8MQB0 B4DN14 Q53EP2 Q5JV59 Q5VZA1 Q86WP8 Q8IZ44 Q8N3Y5 Q8N9L2
Symbols 4.1O
P410
EPB41LO
EPB41L4O

Gene

  Ortholog (11)

Gene RIF (7)

PMID Text
26909942 The risk (G and C) and non-risk (C and T) allele frequencies of the SNPs at the rs1888747 and rs739401 loci of FRMD3 and CARS, respectively, did not differ significantly between the diabetics with (case) and without (control) nephropathy (P > 0.05).
23434934 model for FRMD3 in diabetic nephropathy proposes a possible transcriptional link through which the polymorphism in the FRMD3 promoter could influence transcriptional regulation within the bone morphogenetic protein (BMP)-signaling pathway
21698141 These analyses reveal a role for FRMD3 in AA T2DN susceptibility.
20460425 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19252134 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17260017 identify FRMD3 as a novel putative tumour suppressor gene suggesting an important role in the origin and progression of lung cancer.

AA Sequence

MFASCHCVPRGRRTMKMIHFRSSSVKSLSQEMRCTIRLLDDSEISCHIQRETKGQFLIDHICNYYSLLEK      1 - 70
DYFGIRYVDPEKQRHWLEPNKSIFKQMKTHPPYTMCFRVKFYPHEPLKIKEELTRYLLYLQIKRDIFHGR     71 - 140
LLCSFSDAAYLGACIVQAELGDYDPDEHPENYISEFEIFPKQSQKLERKIVEIHKNELRGQSPPVAEFNL    141 - 210
LLKAHTLETYGVDPHPCKDSTGTTTFLGFTAAGFVVFQGNKRIHLIKWPDVCKLKFEGKTFYVIGTQKEK    211 - 280
KAMLAFHTSTPAACKHLWKCGVENQAFYKYAKSSQIKTVSSSKIFFKGSRFRYSGKVAKEVVEASSKIQR    281 - 350
EPPEVHRANITQSRSSHSLNKQLIINMEPLQPLLPSPSEQEEELPLGEGVPLPKEENISAPLISSSPVKA    351 - 420
AREYEDPPSEEEDKIKEEPLTISELVYNPSASLLPTPVDDDEIDMLFDCPSRLELEREDTDSFEDLEADE    421 - 490
NAFLIAEEEELKEARRALSWSYDILTGHIRVNPLVKSFSRLLVVGLGLLLFVFPLLLLLLESGIDLSFLC    491 - 560
EIRQTPEFEQFHYEYYCPLKEWVAGKVHLILYMLGCS                                     561 - 597
//

Text Mined References (14)

PMID Year Title
26909942 2016 Evaluation of associations between single nucleotide polymorphisms in the FRMD3 and CARS genes and diabetic nephropathy in a Kuwaiti population.
23434934 2013 From single nucleotide polymorphism to transcriptional mechanism: a model for FRMD3 in diabetic nephropathy.
21698141 2011 Differential effects of MYH9 and APOL1 risk variants on FRMD3 Association with Diabetic ESRD in African Americans.
20460425 2010 Replication study for the association between four Loci identified by a genome-wide association study on European American subjects with type 1 diabetes and susceptibility to diabetic nephropathy in Japanese subjects with type 2 diabetes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19252134 2009 Genome-wide association scan for diabetic nephropathy susceptibility genes in type 1 diabetes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17260017 2007 FRMD3, a novel putative tumour suppressor in NSCLC.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
More...