Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.07
PubTator Score 0.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.61269956309902E-31
lung adenocarcinoma 2714 3.68403666403496E-21
non-small cell lung cancer 2798 1.522899044043E-19
ovarian cancer 8492 7.6648016884709E-13
lung carcinoma 2844 4.07471112128477E-10
medulloblastoma 1524 1.54856201944804E-7
glioblastoma 5572 2.26021994369413E-5
pilocytic astrocytoma 3086 4.19520818435498E-5
pediatric high grade glioma 2712 2.99546625215249E-4
astrocytic glioma 2241 5.21553383511648E-4
ependymoma 2514 6.4538108099161E-4
oligodendroglioma 2849 0.00104968962948267
atypical teratoid / rhabdoid tumor 4369 0.00153092997379079
primitive neuroectodermal tumor 3031 0.00164447584836433
medulloblastoma, large-cell 6234 0.00226752564171152
Pick disease 1893 0.00552197548689996
interstitial lung disease 292 0.0166469956566382

Expression

  Differential Expression (17)

Disease log2 FC p
interstitial lung disease -2.000 0.017
astrocytic glioma -3.700 0.001
ependymoma -3.800 0.001
oligodendroglioma -3.500 0.001
glioblastoma -4.000 0.000
medulloblastoma -4.300 0.000
atypical teratoid / rhabdoid tumor -3.000 0.002
medulloblastoma, large-cell -4.200 0.002
primitive neuroectodermal tumor -3.600 0.002
non-small cell lung cancer -2.220 0.000
lung adenocarcinoma -1.500 0.000
pediatric high grade glioma -3.100 0.000
pilocytic astrocytoma -3.400 0.000
psoriasis -2.500 0.000
lung carcinoma -1.200 0.000
Pick disease -1.700 0.006
ovarian cancer -6.300 0.000

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSEPDTSSGFSGSVENGTFLELFPTSLSTSVDPSSGHLSNVYIYVSIFLSLLAFLLLLLIIALQRLKNII      1 - 70
SSSSSYPEYPSDAGSSFTNLEVCSISSQRSTFSNLSS                                      71 - 107
//

Text Mined References (6)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.