Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.07
PubTator Score 0.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -3.000 1.1e-02
astrocytic glioma -3.700 5.2e-04
Astrocytoma, Pilocytic -3.400 3.0e-05
atypical teratoid / rhabdoid tumor -3.000 1.5e-03
ependymoma -3.800 6.5e-04
glioblastoma -3.100 4.7e-07
group 3 medulloblastoma -3.500 2.4e-02
interstitial lung disease -2.000 1.7e-02
lung adenocarcinoma -1.500 3.7e-21
lung carcinoma -1.200 4.1e-10
medulloblastoma, large-cell -4.200 2.3e-03
non-small cell lung cancer -2.220 1.5e-19
oligodendroglioma -3.500 1.0e-03
ovarian cancer -6.300 7.7e-13
Pick disease -1.700 5.5e-03
primitive neuroectodermal tumor -3.600 1.6e-03
psoriasis -1.300 7.0e-13

Gene RIF (1)

AA Sequence

MSEPDTSSGFSGSVENGTFLELFPTSLSTSVDPSSGHLSNVYIYVSIFLSLLAFLLLLLIIALQRLKNII      1 - 70
SSSSSYPEYPSDAGSSFTNLEVCSISSQRSTFSNLSS                                      71 - 107
//

Text Mined References (6)

PMID Year Title