Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.07
PubTator Score 0.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
interstitial lung disease -2.000 0.017
astrocytic glioma -3.700 0.001
ependymoma -3.800 0.001
oligodendroglioma -3.500 0.001
glioblastoma -4.000 0.000
medulloblastoma -4.300 0.000
atypical teratoid / rhabdoid tumor -3.000 0.002
medulloblastoma, large-cell -4.200 0.002
primitive neuroectodermal tumor -3.600 0.002
non-small cell lung cancer -2.220 0.000
lung adenocarcinoma -1.500 0.000
pediatric high grade glioma -3.100 0.000
pilocytic astrocytoma -3.400 0.000
psoriasis -2.500 0.000
lung carcinoma -1.200 0.000
Pick disease -1.700 0.006
ovarian cancer -6.300 0.000

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSEPDTSSGFSGSVENGTFLELFPTSLSTSVDPSSGHLSNVYIYVSIFLSLLAFLLLLLIIALQRLKNII      1 - 70
SSSSSYPEYPSDAGSSFTNLEVCSISSQRSTFSNLSS                                      71 - 107
//

Text Mined References (6)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.