Property Summary

NCBI Gene PubMed Count 14
Grant Count 12
R01 Count 5
Funding $2,612,308.5
PubMed Score 225.68
PubTator Score 18.25

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
26134560 MCPIP1 and MCPIP4 form a complex but they act independently in regulation of IL-6 mRNA degradation.
26059755 The data indicated that ZC3H12D could suppress both the initial inflammation storm and chronic inflammation by targeting the mRNA of cytokines as well as NF-kappaB and c-fos.
22036805 Zc3h12d is a novel negative feedback regulator of TLR signaling and macrophage activation and thus may play a role in host immunity and inflammatory diseases.
18178554 MCPIP1, 2, 3, and 4, encoded by four genes, Zc3h12a, Zc3h12b, Zc3h12c, and Zc3h12d, respectively, regulates macrophage activation.

AA Sequence

MEHPSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVPRGSCGVPDSA      1 - 70
QRGPGTALEEDFRTLASSLRPIVIDGSNVAMSHGNKETFSCRGIKLAVDWFRDRGHTYIKVFVPSWRKDP     71 - 140
PRADTPIREQHVLAELERQAVLVYTPSRKVHGKRLVCYDDRYIVKVAYEQDGVIVSNDNYRDLQSENPEW    141 - 210
KWFIEQRLLMFSFVNDRFMPPDDPLGRHGPSLSNFLSRKPKPPEPSWQHCPYGKKCTYGIKCKFYHPERP    211 - 280
HHAQLAVADELRAKTGARPGAGAEEQRPPRAPGGSAGARAAPREPFAHSLPPARGSPDLAALRGSFSRLA    281 - 350
FSDDLGPLGPPLPVPACSLTPRLGGPDWVSAGGRVPGPLSLPSPESQFSPGDLPPPPGLQLQPRGEHRPR    351 - 420
DLHGDLLSPRRPPDDPWARPPRSDRFPGRSVWAEPAWGDGATGGLSVYATEDDEGDARARARIALYSVFP    421 - 490
RDQVDRVMAAFPELSDLARLILLVQRCQSAGAPLGKP                                     491 - 527
//

Text Mined References (14)

PMID Year Title
26134560 2015 Monocyte Chemotactic Protein-induced Protein 1 and 4 Form a Complex but Act Independently in Regulation of Interleukin-6 mRNA Degradation.
26059755 2015 ZC3H12D attenuated inflammation responses by reducing mRNA stability of proinflammatory genes.
24415781 2014 Posttranscriptional modulation of cytokine production in T cells for the regulation of excessive inflammation by TFL.
22036805 2012 The putative tumor suppressor Zc3h12d modulates toll-like receptor signaling in macrophages.
21732829 2011 Wnt signaling and Dupuytren's disease.
19531561 2009 Inhibition of G(1) to S phase progression by a novel zinc finger protein P58(TFL) at P-bodies.
18178554 2008 A novel CCCH-zinc finger protein family regulates proinflammatory activation of macrophages.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17854321 2007 Deregulation of a possible tumour suppressor gene, ZC3H12D, by translocation of IGK@ in transformed follicular lymphoma with t(2;6)(p12;q25).
17210687 2007 Identification of a novel tumor suppressor gene p34 on human chromosome 6q25.1.
More...