Property Summary

NCBI Gene PubMed Count 14
PubMed Score 225.68
PubTator Score 18.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Expression

Synonym

Accession A2A288 A1L178 B2RXF4 B7WNU7 B9ZZP9 B9ZZQ0 Q6ZRW2
Symbols TFL
p34
MCPIP4
C6orf95
dJ281H8.1

Gene

PANTHER Protein Class (1)

  Ortholog (4)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid

Gene RIF (4)

PMID Text
26134560 MCPIP1 and MCPIP4 form a complex but they act independently in regulation of IL-6 mRNA degradation.
26059755 The data indicated that ZC3H12D could suppress both the initial inflammation storm and chronic inflammation by targeting the mRNA of cytokines as well as NF-kappaB and c-fos.
22036805 Zc3h12d is a novel negative feedback regulator of TLR signaling and macrophage activation and thus may play a role in host immunity and inflammatory diseases.
18178554 MCPIP1, 2, 3, and 4, encoded by four genes, Zc3h12a, Zc3h12b, Zc3h12c, and Zc3h12d, respectively, regulates macrophage activation.

AA Sequence

MEHPSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVPRGSCGVPDSA      1 - 70
QRGPGTALEEDFRTLASSLRPIVIDGSNVAMSHGNKETFSCRGIKLAVDWFRDRGHTYIKVFVPSWRKDP     71 - 140
PRADTPIREQHVLAELERQAVLVYTPSRKVHGKRLVCYDDRYIVKVAYEQDGVIVSNDNYRDLQSENPEW    141 - 210
KWFIEQRLLMFSFVNDRFMPPDDPLGRHGPSLSNFLSRKPKPPEPSWQHCPYGKKCTYGIKCKFYHPERP    211 - 280
HHAQLAVADELRAKTGARPGAGAEEQRPPRAPGGSAGARAAPREPFAHSLPPARGSPDLAALRGSFSRLA    281 - 350
FSDDLGPLGPPLPVPACSLTPRLGGPDWVSAGGRVPGPLSLPSPESQFSPGDLPPPPGLQLQPRGEHRPR    351 - 420
DLHGDLLSPRRPPDDPWARPPRSDRFPGRSVWAEPAWGDGATGGLSVYATEDDEGDARARARIALYSVFP    421 - 490
RDQVDRVMAAFPELSDLARLILLVQRCQSAGAPLGKP                                     491 - 527
//

Text Mined References (14)

PMID Year Title
26134560 2015 Monocyte Chemotactic Protein-induced Protein 1 and 4 Form a Complex but Act Independently in Regulation of Interleukin-6 mRNA Degradation.
26059755 2015 ZC3H12D attenuated inflammation responses by reducing mRNA stability of proinflammatory genes.
24415781 2014 Posttranscriptional modulation of cytokine production in T cells for the regulation of excessive inflammation by TFL.
22036805 2012 The putative tumor suppressor Zc3h12d modulates toll-like receptor signaling in macrophages.
21732829 2011 Wnt signaling and Dupuytren's disease.
19531561 2009 Inhibition of G(1) to S phase progression by a novel zinc finger protein P58(TFL) at P-bodies.
18178554 2008 A novel CCCH-zinc finger protein family regulates proinflammatory activation of macrophages.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17854321 2007 Deregulation of a possible tumour suppressor gene, ZC3H12D, by translocation of IGK@ in transformed follicular lymphoma with t(2;6)(p12;q25).
17210687 2007 Identification of a novel tumor suppressor gene p34 on human chromosome 6q25.1.
More...