Property Summary

NCBI Gene PubMed Count 15
PubMed Score 236.04
PubTator Score 18.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (5)

AA Sequence

MEHPSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVPRGSCGVPDSA      1 - 70
QRGPGTALEEDFRTLASSLRPIVIDGSNVAMSHGNKETFSCRGIKLAVDWFRDRGHTYIKVFVPSWRKDP     71 - 140
PRADTPIREQHVLAELERQAVLVYTPSRKVHGKRLVCYDDRYIVKVAYEQDGVIVSNDNYRDLQSENPEW    141 - 210
KWFIEQRLLMFSFVNDRFMPPDDPLGRHGPSLSNFLSRKPKPPEPSWQHCPYGKKCTYGIKCKFYHPERP    211 - 280
HHAQLAVADELRAKTGARPGAGAEEQRPPRAPGGSAGARAAPREPFAHSLPPARGSPDLAALRGSFSRLA    281 - 350
FSDDLGPLGPPLPVPACSLTPRLGGPDWVSAGGRVPGPLSLPSPESQFSPGDLPPPPGLQLQPRGEHRPR    351 - 420
DLHGDLLSPRRPPDDPWARPPRSDRFPGRSVWAEPAWGDGATGGLSVYATEDDEGDARARARIALYSVFP    421 - 490
RDQVDRVMAAFPELSDLARLILLVQRCQSAGAPLGKP                                     491 - 527
//

Text Mined References (15)

PMID Year Title