Property Summary

NCBI Gene PubMed Count 28
PubMed Score 14.49
PubTator Score 17.70

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma -3.100 6.5e-08
astrocytic glioma -2.200 6.2e-03
Astrocytoma, Pilocytic -1.200 7.0e-05
Atopic dermatitis -1.300 3.8e-06
atypical teratoid / rhabdoid tumor -2.700 3.0e-07
chronic lymphosyte leukemia -1.600 2.3e-09
ependymoma -1.900 2.3e-02
glioblastoma -2.300 2.2e-08
interstitial cystitis -1.900 1.4e-03
intraductal papillary-mucinous adenoma (... 1.400 7.7e-04
intraductal papillary-mucinous neoplasm ... 2.600 5.5e-03
medulloblastoma -1.500 9.7e-04
medulloblastoma, large-cell -2.200 1.2e-04
non-small cell lung cancer -2.928 1.3e-17
oligodendroglioma -1.900 2.0e-02
osteosarcoma -1.620 2.4e-04
pancreatic cancer 1.500 5.1e-03
Pick disease -1.400 4.5e-03
pituitary cancer 1.400 3.7e-07
primitive neuroectodermal tumor -2.200 1.8e-04
psoriasis -1.900 9.4e-44
tuberculosis 1.500 1.1e-03

Gene RIF (15)

AA Sequence

MYPSNKKKKVWREEKERLLKMTLEERRKEYLRDYIPLNSILSWKEEMKGKGQNDEENTQETSQVKKSLTE      1 - 70
KVSLYRGDITLLEVDAIVNAANASLLGGGGVDGCIHRAAGPCLLAECRNLNGCDTGHAKITCGYDLPAKY     71 - 140
VIHTVGPIARGHINGSHKEDLANCYKSSLKLVKENNIRSVAFPCISTGIYGFPNEPAAVIALNTIKEWLA    141 - 210
KNHHEVDRIIFCVFLEVDFKIYKKKMNEFFSVDDNNEEEEDVEMKEDSDENGPEEKQSVEEMEEQSQDAD    211 - 280
GVNTVTVPGPASEEAVEDCKDEDFAKDENITKGGEVTDHSVRDQDHPDGQENDSTKNEIKIETESQSSYM    281 - 350
ETEELSSNQEDAVIVEQPEVIPLTEDQEEKEGEKAPGEDTPRMPGKSEGSSDLENTPGPDVEMNSQVDKV    351 - 420
NDPTESQQEDQLIAGAQDEAKEQRNGTK                                              421 - 448
//

Text Mined References (32)

PMID Year Title