Property Summary

NCBI Gene PubMed Count 25
PubMed Score 13.55
PubTator Score 17.70

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A1Z1Q3 A6NFF7 B0QZ39 B3KWV0 Q0P6D5 Q495E0 Q5W199 Q6ZN71
Symbols C20orf133

Gene

PDB

4IQY  

Gene RIF (13)

PMID Text
25422431 MACROD2 is a key mediator of estrogen independent growth and tamoxifen resistance
25360606 MACROD2 gene is a strong positional candidate risk factor for autistic-like traits in the general population
21656903 this study does not provide support for the reported association between rs4141463, within the MACROD2 gene and autism.
20663923 An analysis of 1 million single-nucleotide polymorphisms found a possible commonality for autism in the allele at rs4141463 located in MACROD2.
20663923 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20044523 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
19847924 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
18987618 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MYPSNKKKKVWREEKERLLKMTLEERRKEYLRDYIPLNSILSWKEEMKGKGQNDEENTQETSQVKKSLTE      1 - 70
KVSLYRGDITLLEVDAIVNAANASLLGGGGVDGCIHRAAGPCLLAECRNLNGCDTGHAKITCGYDLPAKY     71 - 140
VIHTVGPIARGHINGSHKEDLANCYKSSLKLVKENNIRSVAFPCISTGIYGFPNEPAAVIALNTIKEWLA    141 - 210
KNHHEVDRIIFCVFLEVDFKIYKKKMNEFFSVDDNNEEEEDVEMKEDSDENGPEEKQSVEEMEEQSQDAD    211 - 280
GVNTVTVPGPASEEAVEDCKDEDFAKDENITKGGEVTDHSVRDQDHPDGQENDSTKNEIKIETESQSSYM    281 - 350
ETEELSSNQEDAVIVEQPEVIPLTEDQEEKEGEKAPGEDTPRMPGKSEGSSDLENTPGPDVEMNSQVDKV    351 - 420
NDPTESQQEDQLIAGAQDEAKEQRNGTK                                              421 - 448
//

Text Mined References (29)

PMID Year Title
25422431 2014 MACROD2 overexpression mediates estrogen independent growth and tamoxifen resistance in breast cancers.
25360606 2014 MACROD2 gene associated with autistic-like traits in a general population sample.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
23568457 2013 Genetic variants associated with disordered eating.
23509613 2013 Genome-wide association study of antiphospholipid antibodies.
23474712 2013 A family of macrodomain proteins reverses cellular mono-ADP-ribosylation.
23471985 2013 Genome-wide scan of healthy human connectome discovers SPON1 gene variant influencing dementia severity.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22633400 2012 Genome-wide association study identifies candidate genes for male fertility traits in humans.
21656903 2011 No association between a common single nucleotide polymorphism, rs4141463, in the MACROD2 gene and autism spectrum disorder.
More...