Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.92
PubTator Score 14.07

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
26542693 ZBTB7C genetic variations were significant for susceptibility to ischemic injury in cerebral ischemia.
22253232 our findings define KR-POK as a transcriptional repressor with a pro-oncogenic role that relies upon binding to p53 and inhibition of its transactivation function.
17932560 Adm and APM-1 protect endothelium-dependent vascular relaxation in sepsis.

AA Sequence

MANDIDELIGIPFPNHSSEVLCSLNEQRHDGLLCDVLLVVQEQEYRTHRSVLAACSKYFKKLFTAGTLAS      1 - 70
QPYVYEIDFVQPEALAAILEFAYTSTLTITAGNVKHILNAARMLEIQCIVNVCLEIMEPGGDGGEEDDKE     71 - 140
DDDDDEDDDDEEDEEEEEEEEEDDDDDTEDFADQENLPDPQDISCHQSPSKTDHLTEKAYSDTPRDFPDS    141 - 210
FQAGSPGHLGVIRDFSIESLLRENLYPKANIPDRRPSLSPFAPDFFPHLWPGDFGAFAQLPEQPMDSGPL    211 - 280
DLVIKNRKIKEEEKEELPPPPPPPFPNDFFKDMFPDLPGGPLGPIKAENDYGAYLNFLSATHLGGLFPPW    281 - 350
PLVEERKLKPKASQQCPICHKVIMGAGKLPRHMRTHTGEKPYMCTICEVRFTRQDKLKIHMRKHTGERPY    351 - 420
LCIHCNAKFVHNYDLKNHMRIHTGVRPYQCEFCYKSFTRSDHLHRHIKRQSCRMARPRRGRKPAAWRAAS    421 - 490
LLFGPGGPAPDKAAFVMPPALGEVGGHLGGAAVCLPGPSPAKHFLAAPKGALSLQELERQFEETQMKLFG    491 - 560
RAQLEAERNAGGLLAFALAENVAAARPYFPLPDPWAAGLAGLPGLAGLNHVASMSEANN               561 - 619
//

Text Mined References (9)

PMID Year Title
26542693 2015 Integrative Mouse and Human Studies Implicate ANGPT1 and ZBTB7C as Susceptibility Genes to Ischemic Injury.
23456168 2013 Genome-wide association study in Han Chinese identifies three novel loci for human height.
23006423 2012 Genetic association with overall survival of taxane-treated lung cancer patients - a genome-wide association study in human lymphoblastoid cell lines followed by a clinical association study.
22253232 2012 KR-POK interacts with p53 and represses its ability to activate transcription of p21WAF1/CDKN1A.
17932560 Adrenomedullin and adrenomedullin binding protein-1 protect endothelium-dependent vascular relaxation in sepsis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
9427755 1998 APM-1, a novel human gene, identified by aberrant co-transcription with papillomavirus oncogenes in a cervical carcinoma cell line, encodes a BTB/POZ-zinc finger protein with growth inhibitory activity.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
1716694 1991 Characterization of a novel human papillomavirus DNA in the cervical carcinoma cell line ME180.