Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.26
PubTator Score 14.07

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A1YPR0 O73453
Symbols APM1
APM-1
ZBTB36
ZNF857C

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

Gene RIF (4)

AA Sequence

MANDIDELIGIPFPNHSSEVLCSLNEQRHDGLLCDVLLVVQEQEYRTHRSVLAACSKYFKKLFTAGTLAS      1 - 70
QPYVYEIDFVQPEALAAILEFAYTSTLTITAGNVKHILNAARMLEIQCIVNVCLEIMEPGGDGGEEDDKE     71 - 140
DDDDDEDDDDEEDEEEEEEEEEDDDDDTEDFADQENLPDPQDISCHQSPSKTDHLTEKAYSDTPRDFPDS    141 - 210
FQAGSPGHLGVIRDFSIESLLRENLYPKANIPDRRPSLSPFAPDFFPHLWPGDFGAFAQLPEQPMDSGPL    211 - 280
DLVIKNRKIKEEEKEELPPPPPPPFPNDFFKDMFPDLPGGPLGPIKAENDYGAYLNFLSATHLGGLFPPW    281 - 350
PLVEERKLKPKASQQCPICHKVIMGAGKLPRHMRTHTGEKPYMCTICEVRFTRQDKLKIHMRKHTGERPY    351 - 420
LCIHCNAKFVHNYDLKNHMRIHTGVRPYQCEFCYKSFTRSDHLHRHIKRQSCRMARPRRGRKPAAWRAAS    421 - 490
LLFGPGGPAPDKAAFVMPPALGEVGGHLGGAAVCLPGPSPAKHFLAAPKGALSLQELERQFEETQMKLFG    491 - 560
RAQLEAERNAGGLLAFALAENVAAARPYFPLPDPWAAGLAGLPGLAGLNHVASMSEANN               561 - 619
//

Text Mined References (10)

PMID Year Title