Property Summary

NCBI Gene PubMed Count 7
PubMed Score 6.14
PubTator Score 5.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (2)

PMID Text
19059705 FAM92A1-289 is a new tumor-related gene with oncogenic potentials to probably play roles in renal carcinogenesis.
17646714 FAM92A1 has different splicing variants, and that it may take part in regulating cell proliferation and apoptosis.

AA Sequence

MMRRTLENRNAQTKQLQTAVSNVEKHFGELCQIFAAYVRKTARLRDKADLLVNEINAYAATETPHLKLGL      1 - 70
MNFADEFAKLQDYRQAEVERLEAKVVEPLKTYGTIVKMKRDDLKATLTARNREAKQLTQLERTRQRNPSD     71 - 140
RHVISQAETELQRAAMDASRTSRHLEETINNFERQKMKDIKTIFSEFITIEMLFHGKALEVYTAAYQNIQ    141 - 210
NIDEDEDLEVFRNSLYAPDYSSRLDIVRANSKSPLQRSLSAKCVSGTGQVSTCRLRKDQQAEDDEDDELD    211 - 280
VTEEENFLK                                                                 281 - 289
//

Text Mined References (10)

PMID Year Title
27528616 2016 BAR Domain-Containing FAM92 Proteins Interact with Chibby1 To Facilitate Ciliogenesis.
25416956 2014 A proteome-scale map of the human interactome network.
22832960 2012 A genome-wide meta-analysis of association studies of Cloninger's Temperament Scales.
19059705 2009 Prokaryotic expression, purification of a new tumor-relative protein FAM92A1-289 and its characterization in renal cell carcinoma.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17646714 2007 Identification and characterization of two novel variants of the DUF1208 protein FAM92A1.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.