Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.14
PubTator Score 5.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
active Crohn's disease 1.629 7.1e-03
intraductal papillary-mucinous adenoma (... -1.300 2.0e-03
invasive ductal carcinoma -1.200 6.0e-03
lung cancer 1.200 3.2e-03
malignant mesothelioma 1.200 2.6e-05
posterior fossa group B ependymoma 1.100 1.1e-07
ulcerative colitis 1.200 1.8e-06

Gene RIF (4)

AA Sequence

MMRRTLENRNAQTKQLQTAVSNVEKHFGELCQIFAAYVRKTARLRDKADLLVNEINAYAATETPHLKLGL      1 - 70
MNFADEFAKLQDYRQAEVERLEAKVVEPLKTYGTIVKMKRDDLKATLTARNREAKQLTQLERTRQRNPSD     71 - 140
RHVISQAETELQRAAMDASRTSRHLEETINNFERQKMKDIKTIFSEFITIEMLFHGKALEVYTAAYQNIQ    141 - 210
NIDEDEDLEVFRNSLYAPDYSSRLDIVRANSKSPLQRSLSAKCVSGTGQVSTCRLRKDQQAEDDEDDELD    211 - 280
VTEEENFLK                                                                 281 - 289
//

Text Mined References (11)

PMID Year Title