Property Summary

NCBI Gene PubMed Count 23
PubMed Score 47.19
PubTator Score 15.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma multiforme 1.300 0.000
osteosarcoma 1.822 0.006
primary pancreatic ductal adenocarcinoma 1.830 0.012
interstitial cystitis 1.200 0.002
gastric carcinoma 1.100 0.012
ovarian cancer 1.500 0.001
pancreatic cancer 1.600 0.023

Synonym

Accession A1X283 B6F0V2 Q9P2Q1
Symbols FTHS
HOFI
TKS4
TSK4
FAD49
KIAA1295

Gene

Gene RIF (9)

PMID Text
26183326 Misfolded Frank-ter Haar syndrome protein Tks4(R43W) is transported via the microtubule system to the aggresomes.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of SH3 and PX domains 2B (SH3PXD2B; KIAA1295) in peptide-treated PBMCs
22829589 a new function for Tks4 in the regulation of growth factor-dependent cell migration.
21886807 SH3PXD2B is a scaffold protein that plays a key role in regulating the actin cytoskeleton via Src and cortactin.
20943948 The Nox1-dependent generation of reactive oxygen species is dependent on Src phosphorylation of NoxA1 and Tks4. Blockage of phosphorylation of NoxA1 and Tks4 decreases Nox1-dependent ROS generation and blocks SrcYF-induced invadopodia formation.
20609497 Tks4 and Tks5 directly bind to NoxA1. The integrity of the N-terminal PRR of NoxA1 is essential for this direct interaction with the Tks proteins.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20137777 These findings establish a role for TKS4 in Frank-Ter Haar syndrome and embryonic development.
19228371 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPPRRSIVEVKVLDVQKRRVPNKHYVYIIRVTWSSGSTEAIYRRYSKFFDLQMQMLDKFPMEGGQKDPKQ      1 - 70
RIIPFLPGKILFRRSHIRDVAVKRLIPIDEYCKALIQLPPYISQCDEVLQFFETRPEDLNPPKEEHIGKK     71 - 140
KSGGDQTSVDPMVLEQYVVVANYQKQESSEISLSVGQVVDIIEKNESGWWFVSTAEEQGWVPATCLEGQD    141 - 210
GVQDEFSLQPEEEEKYTVIYPYTARDQDEMNLERGAVVEVIQKNLEGWWKIRYQGKEGWAPASYLKKNSG    211 - 280
EPLPPKPGPGSPSHPGALDLDGVSRQQNAVGREKELLSSQRDGRFEGRPVPDGDAKQRSPKMRQRPPPRR    281 - 350
DMTIPRGLNLPKPPIPPQVEEEYYTIAEFQTTIPDGISFQAGLKVEVIEKNLSGWWYIQIEDKEGWAPAT    351 - 420
FIDKYKKTSNASRPNFLAPLPHEVTQLRLGEAAALENNTGSEATGPSRPLPDAPHGVMDSGLPWSKDWKG    421 - 490
SKDVLRKASSDMSASAGYEEISDPDMEEKPSLPPRKESIIKSEGELLERERERQRTEQLRGPTPKPPGVI    491 - 560
LPMMPAKHIPPARDSRRPEPKPDKSRLFQLKNDMGLECGHKVLAKEVKKPNLRPISKSKTDLPEEKPDAT    561 - 630
PQNPFLKSRPQVRPKPAPSPKTEPPQGEDQVDICNLRSKLRPAKSQDKSLLDGEGPQAVGGQDVAFSRSF    631 - 700
LPGEGPGRAQDRTGKQDGLSPKEISCRAPPRPAKTTDPVSKSVPVPLQEAPQQRPVVPPRRPPPPKKTSS    701 - 770
SSRPLPEVRGPQCEGHESRAAPTPGRALLVPPKAKPFLSNSLGGQDDTRGKGSLGPWGTGKIGENREKAA    771 - 840
AASVPNADGLKDSLYVAVADFEGDKDTSSFQEGTVFEVREKNSSGWWFCQVLSGAPSWEGWIPSNYLRKK    841 - 910
P//

Text Mined References (30)

PMID Year Title
26183326 2015 Accumulation of the PX domain mutant Frank-ter Haar syndrome protein Tks4 in aggresomes.
25133637 2014 Genome-wide association studies and heritability estimates of body mass index related phenotypes in Bangladeshi adults.
24598923 2014 Expression, purification and preliminary crystallographic studies of the C-terminal SH3 domain of human Tks4.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24105366 2014 Mutations in SH3PXD2B cause Borrone dermato-cardio-skeletal syndrome.
23140272 2012 Frank-ter Haar syndrome associated with sagittal craniosynostosis and raised intracranial pressure.
22829589 2012 Frank-ter Haar syndrome protein Tks4 regulates epidermal growth factor-dependent cell migration.
22509100 2012 Localization of SH3PXD2B in human eyes and detection of rare variants in patients with anterior segment diseases and glaucoma.
22260678 2012 Cell migration and invasion in human disease: the Tks adaptor proteins.
21886807 2011 The homolog of the five SH3-domain protein (HOFI/SH3PXD2B) regulates lamellipodia formation and cell spreading.
More...