Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.33

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 4.0e-08
diabetes mellitus 1728 1.5e-03


  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.100 1.5e-03
osteosarcoma -1.438 4.0e-08

AA Sequence

VHCCWAFSICQVARELKMRTSQVYEICAVPMTKDTLV                                     141 - 177

Text Mined References (5)

PMID Year Title