Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
diabetes mellitus 1,663
osteosarcoma 7,933

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.438 0.000
diabetes mellitus 1.100 0.001

Synonym

Accession A1L4L8
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MNWFGSNFFRCPEDLSLLNIYSPLLSHMSSEDEHFISNLRGHVPASAVVKQPVRGASGRTTITAIVQTGG      1 - 70
GWSTGLFSVCRDRRICFCGLFCPMCLECDIARHYGECLCWPLLPGSTFALRIGTRERHKIQGTLCEDWLA     71 - 140
VHCCWAFSICQVARELKMRTSQVYEICAVPMTKDTLV                                     141 - 177
//

Text Mined References (2)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.