Property Summary

NCBI Gene PubMed Count 2
PubMed Score 2.70
PubTator Score 3.33

Knowledge Summary

Patent

No data available

AA Sequence

MAAPASVMGPLGPSALGLLLLLLVVAPPRVAALVHRQPENQGISLTGSVACGRPSMEGKILGGVPAPERK      1 - 70
WPWQVSVHYAGLHVCGGSILNEYWVLSAAHCFHRDKNIKIYDMYVGLVNLRVAGNHTQWYEVNRVILHPT     71 - 140
YEMYHPIGGDVALVQLKTRIVFSESVLPVCLATPEVNLTSANCWATGWGLVSKQGETSDELQEMQLPLIL    141 - 210
EPWCHLLYGHMSYIMPDMLCAGDILNAKTVCEGDSGGPLVCEFNRSWLQIGIVSWGRGCSNPLYPGVYAS    211 - 280
VSYFSKWICDNIEITPTPAQPAPALSPALGPTLSVLMAMLAGWSVL                            281 - 326
//

Text Mined References (4)

PMID Year Title