Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

 GO Function (1)

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MDLSCSCATGGSCTCASSCKCKEYKCTSCKKNCCSCCPMGCAKCAQGCT                           1 - 49
//

Text Mined References (9)

PMID Year Title