Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Synonym

Accession A1L3X4 Q86YX1
Symbols MTM

Gene

 GO Function (1)

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
25261601 The close relationship between Runx2 and YAP plays a pro-carcinogenetic role in liver cancer cells through inhibiting tumor suppressor lncRNA, MT1DP in a FoxA1 dependent manner.

AA Sequence

MDLSCSCATGGSCTCASSCKCKEYKCTSCKKNCCSCCPMGCAKCAQGCT                           1 - 49
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25261601 2014 Tumor suppressor long non-coding RNA, MT1DP is negatively regulated by YAP and Runx2 to inhibit FoxA1 in liver cancer cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
6327055 1984 Structural and functional analysis of the human metallothionein-IA gene: differential induction by metal ions and glucocorticoids.
6089206 1984 Human metallothionein genes are clustered on chromosome 16.
3856101 1985 Metallothionein gene cluster is split by chromosome 16 rearrangements in myelomonocytic leukaemia.
3785191 1986 Structure and tissue-specific expression of the human metallothionein IB gene.
2286373 1990 Human metallothionein genes: structure of the functional locus at 16q13.