Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.80
PubTator Score 4.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute myeloid leukemia -2.900 2.2e-02
adult high grade glioma -1.700 2.8e-04
astrocytic glioma -1.500 1.8e-02
atypical teratoid / rhabdoid tumor -1.600 3.8e-03
gastric cancer 1.500 6.8e-03
glioblastoma -1.800 9.8e-05
group 3 medulloblastoma -2.200 2.1e-05
interstitial cystitis 1.400 9.0e-03
lung carcinoma 1.100 1.3e-06
medulloblastoma, large-cell -3.100 4.2e-06
oligodendroglioma -1.500 1.6e-02
osteosarcoma -2.299 1.6e-02
ovarian cancer -1.400 2.3e-03
pancreatic cancer 1.900 1.3e-03
pancreatic carcinoma 1.900 1.3e-03
primitive neuroectodermal tumor -2.000 1.0e-02
progressive supranuclear palsy -1.100 4.9e-02
psoriasis 1.100 4.9e-31
spina bifida -1.531 3.9e-02
tuberculosis -1.500 5.6e-03

Gene RIF (5)

AA Sequence

MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKAMIT      1 - 70
YNFFIVLFSVYMCYEFVMSGWGIGYSFRCDIVDYSRSPTALRMARTCWLYYFSKFIELLDTIFFVLRKKN     71 - 140
SQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYSYYGLSALGPAYQKYLWWKKYLTSL    141 - 210
QLVQFVIVAIHISQFFFMEDCKYQFPVFACIIMSYSFMFLLLFLHFWYRAYTKGQRLPKTVKNGTCKNKD    211 - 280
N//

Text Mined References (13)

PMID Year Title