Property Summary

NCBI Gene PubMed Count 9
Grant Count 4
R01 Count 4
Funding $408,166.67
PubMed Score 4.96
PubTator Score 4.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
gastric cancer 1.500 0.007
pancreatic cancer 1.900 0.001
astrocytic glioma -1.500 0.018
oligodendroglioma -1.500 0.016
osteosarcoma -2.299 0.016
glioblastoma -2.000 0.001
medulloblastoma -2.400 0.000
atypical teratoid/rhabdoid tumor -1.700 0.000
medulloblastoma, large-cell -3.100 0.000
primitive neuroectodermal tumor -2.000 0.010
tuberculosis and treatment for 6 months -2.200 0.001
interstitial cystitis 1.400 0.009
pediatric high grade glioma -2.000 0.000
pancreatic carcinoma 1.900 0.001
psoriasis 1.400 0.000
lung carcinoma 1.100 0.000
spina bifida -1.531 0.039
progressive supranuclear palsy -1.100 0.049
acute myeloid leukemia -2.900 0.022
ovarian cancer -1.400 0.002

Synonym

Accession A1L3X0 Q589T3 Q9H5D0 Q9NT66
Symbols

Gene

PANTHER Protein Class (2)

Gene RIF (4)

PMID Text
25732827 ELOVL7 knockdown or mTOR inhibition impairs HCMV-induced fatty acid elongation.
21959040 progression of the VLCFA cycle enhances ELOVL7 activity.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19826053 Overexpression of ELOVL7 is associated with prostate cancer growth through saturated long-chain fatty acid metabolism.

AA Sequence

MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKAMIT      1 - 70
YNFFIVLFSVYMCYEFVMSGWGIGYSFRCDIVDYSRSPTALRMARTCWLYYFSKFIELLDTIFFVLRKKN     71 - 140
SQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYSYYGLSALGPAYQKYLWWKKYLTSL    141 - 210
QLVQFVIVAIHISQFFFMEDCKYQFPVFACIIMSYSFMFLLLFLHFWYRAYTKGQRLPKTVKNGTCKNKD    211 - 280
N//

Text Mined References (12)

PMID Year Title
25732827 2015 Fatty acid elongase 7 catalyzes lipidome remodeling essential for human cytomegalovirus replication.
25416956 2014 A proteome-scale map of the human interactome network.
21959040 2011 Biochemical characterization of the very long-chain fatty acid elongase ELOVL7.
20937905 2010 ELOVL1 production of C24 acyl-CoAs is linked to C24 sphingolipid synthesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19826053 2009 Novel lipogenic enzyme ELOVL7 is involved in prostate cancer growth through saturated long-chain fatty acid metabolism.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...