Property Summary

NCBI Gene PubMed Count 5
Grant Count 4
R01 Count 4
Funding $217,748.25
PubMed Score 6.63
PubTator Score 1.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Infertility 163 3.198 1.6
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.700 0.000

Synonym

Accession A1L190
Symbols THEG2
C22orf41

Gene

Gene RIF (1)

PMID Text
19323366 Cloning and expression analysis of a similar gene in mouse.

AA Sequence

MDDADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCK      1 - 70
EEMEKNWQELLHETKQRL                                                         71 - 88
//

Text Mined References (5)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21637789 2011 A novel mouse synaptonemal complex protein is essential for loading of central element proteins, recombination, and fertility.
19323366 2009 [Cloning and expression of a novel mouse testis gene TSEG-2].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.