Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.67
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
medulloblastoma 1,524

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma -1.200 0.009

AA Sequence

MSANGAVWGRVRSRLRAFPERLAACGAEAAAYGRCVQASTAPGGRLSKDFCAREFEALRSCFAAAAKKTL      1 - 70
EGGC                                                                       71 - 74
//

Text Mined References (4)

PMID Year Title
27499296 2016 Mitochondrial Protein Interaction Mapping Identifies Regulators of Respiratory Chain Function.
17287340 2007 Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.