Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
group 4 medulloblastoma -1.200 6.1e-04
medulloblastoma, large-cell -1.200 2.5e-04
primitive neuroectodermal tumor -1.100 5.9e-05

AA Sequence

MYKSKIPRAQNQVSVKVTPKNTEMKIAEEPSPSLGQTLEWLRKELSEMQIQDQSLLLTLRHLHSVLEELR      1 - 70
ADSAHWEDARSSGGTSPIRARAGSEGRGCQPVCSRGLAQLLRGEDSRRSSLP                       71 - 122
//

Text Mined References (3)

PMID Year Title