Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.24
PubTator Score 1.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
acute quadriplegic myopathy -1.095 1.1e-03
adrenocortical carcinoma 1.619 4.5e-02
adult high grade glioma -3.600 4.8e-06
astrocytic glioma -2.600 4.2e-03
Astrocytoma, Pilocytic -3.000 2.8e-08
atypical teratoid / rhabdoid tumor -6.100 2.7e-11
ependymoma -3.200 1.1e-02
gastric carcinoma -2.700 1.8e-02
glioblastoma -3.400 2.1e-08
group 3 medulloblastoma -1.900 3.3e-02
invasive ductal carcinoma 1.804 5.8e-04
medulloblastoma, large-cell -5.700 6.0e-07
oligodendroglioma -1.500 3.9e-02
Pick disease -1.700 3.9e-02
primitive neuroectodermal tumor -2.300 8.2e-03
psoriasis -1.300 1.2e-06
subependymal giant cell astrocytoma -2.344 8.4e-03
tuberculosis -1.400 1.5e-04
X-linked cerebral adrenoleukodystrophy 1.500 4.7e-02

Gene RIF (1)

AA Sequence

MKELQDIARLSDRFISVELVDESLFDWNVKLHQVDKDSVLWQDMKETNTEFILLNLTFPDNFPFSPPFMR      1 - 70
VLSPRLENGYVLDGGAICMELLTPRGWSSAYTVEAVMRQFAASLVKGQGRICRKAGKSKKSFSRKEAEAT     71 - 140
FKSLVKTHEKYGWVTPPVSDG                                                     141 - 161
//

Text Mined References (5)

PMID Year Title