Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.24
PubTator Score 1.06

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
24000165 UBE2QL1 as a novel candidate renal tumor suppressor gene.

AA Sequence

MKELQDIARLSDRFISVELVDESLFDWNVKLHQVDKDSVLWQDMKETNTEFILLNLTFPDNFPFSPPFMR      1 - 70
VLSPRLENGYVLDGGAICMELLTPRGWSSAYTVEAVMRQFAASLVKGQGRICRKAGKSKKSFSRKEAEAT     71 - 140
FKSLVKTHEKYGWVTPPVSDG                                                     141 - 161
//

Text Mined References (5)

PMID Year Title
24000165 2013 UBE2QL1 is disrupted by a constitutional translocation associated with renal tumor predisposition and is a novel candidate renal tumor suppressor gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.