Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.6e-13

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 1.6e-13

AA Sequence

METVNEPETGEVSKDAVIVKQEKNNEYCLQDIDDKLSESAEDDGEDDTNDEDDDEDSNPKKNTQAPLELM      1 - 70
AEFLRAEMAREYQLAKKLCQMILIYEPENPEAKEFFTLIEEMLLMEKTQNHEQDGENSDEDSSGESKGES     71 - 140
DEELSDESSDEGEDGS                                                          141 - 156
//

Text Mined References (3)

PMID Year Title