Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 0.000

Synonym

Accession A1L162 A7E2T7
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

METVNEPETGEVSKDAVIVKQEKNNEYCLQDIDDKLSESAEDDGEDDTNDEDDDEDSNPKKNTQAPLELM      1 - 70
AEFLRAEMAREYQLAKKLCQMILIYEPENPEAKEFFTLIEEMLLMEKTQNHEQDGENSDEDSSGESKGES     71 - 140
DEELSDESSDEGEDGS                                                          141 - 156
//

Text Mined References (3)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.