Property Summary

NCBI Gene PubMed Count 5
PubMed Score 119.72
PubTator Score 47.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Rosacea 25 3.642 1.8
Localized scleroderma 9 3.215 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
interstitial cystitis -1.100 2.4e-05
ovarian cancer 1.900 1.0e-04
pancreatic ductal adenocarcinoma liver m... -1.125 2.0e-02
psoriasis 1.300 9.1e-04

AA Sequence

METPAAAAPAGSLFPSFLLLACGTLVAALLGAAHRLGLFYQLLHKVDKASVRHGGENVAAVLRAHGVRFI      1 - 70
FTLVGGHISPLLVACEKLGIRVVDTRHEVTAVFAADAMARLSGTVGVAAVTAGPGLTNTVTAVKNAQMAQ     71 - 140
SPILLLGGAASTLLQNRGALQAVDQLSLFRPLCKFCVSVRRVRDIVPTLRAAMAAAQSGTPGPVFVELPV    141 - 210
DVLYPYFMVQKEMVPAKPPKGLVGRVVSWYLENYLANLFAGAWEPQPEGPLPLDIPQASPQQVQRCVEIL    211 - 280
SRAKRPLMVLGSQALLTPTSADKLRAAVETLGVPCFLGGMARGLLGRNHPLHIRENRSAALKKADVIVLA    281 - 350
GTVCDFRLSYGRVLSHSSKIIIVNRNREEMLLNSDIFWKPQEAVQGDVGSFVLKLVEGLQGQTWAPDWVE    351 - 420
ELREADRQKEQTFREKAAMPVAQHLNPVQVLQLVEETLPDNSILVVDGGDFVGTAAHLVQPRGPLRWLDP    421 - 490
GAFGTLGVGAGFALGAKLCRPDAEVWCLFGDGAFGYSLIEFDTFVRHKIPVMALVGNDAGWTQISREQVP    491 - 560
SLGSNVACGLAYTDYHKAAMGLGARGLLLSRENEDQVVKVLHDAQQQCRDGHPVVVNILIGRTDFRDGSI    561 - 630
AV                                                                        631 - 632
//

Text Mined References (9)

PMID Year Title