Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.61
PubTator Score 1.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
urothelial carcinoma 1.400 0.015
oligodendroglioma 1.100 0.000
osteosarcoma 1.362 0.008
ependymoma 1.700 0.000
glioblastoma 2.000 0.001
group 4 medulloblastoma 4.000 0.000
atypical teratoid / rhabdoid tumor 2.600 0.000
medulloblastoma, large-cell 3.600 0.000
primitive neuroectodermal tumor 3.300 0.000
breast carcinoma 1.100 0.010
fibroadenoma 1.400 0.049
pediatric high grade glioma 1.700 0.000
lung adenocarcinoma 2.800 0.000
ductal carcinoma in situ 1.100 0.008
invasive ductal carcinoma 1.600 0.007
ovarian cancer 1.400 0.000
Breast cancer 1.600 0.000

Synonym

Accession A1L020
Symbols RKHD4
MEX-3A

Gene

AA Sequence

MPSLVVSGIMERNGGFGELGCFGGSAKDRGLLEDERALQLALDQLCLLGLGEPPAPTAGEDGGGGGGGAP      1 - 70
AQPAAPPQPAPPPPPAAPPAAPTAAPAAQTPQPPTAPKGASDAKLCALYKEAELRLKGSSNTTECVPVPT     71 - 140
SEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFMVTGRREDVATARREIISAAEHFSMIRASRNKS    141 - 210
GAAFGVAPALPGQVTIRVRVPYRVVGLVVGPKGATIKRIQQQTNTYIITPSRDRDPVFEITGAPGNVERA    211 - 280
REEIETHIAVRTGKILEYNNENDFLAGSPDAAIDSRYSDAWRVHQPGCKPLSTFRQNSLGCIGECGVDSG    281 - 350
FEAPRLGEQGGDFGYGGYLFPGYGVGKQDVYYGVAETSPPLWAGQENATPTSVLFSSASSSSSSSAKARA    351 - 420
GPPGAHRSPATSAGPELAGLPRRPPGEPLQGFSKLGGGGLRSPGGGRDCMVCFESEVTAALVPCGHNLFC    421 - 490
MECAVRICERTDPECPVCHITATQAIRIFS                                            491 - 520
//

Text Mined References (5)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
17267406 2007 Identification and characterization of human Mex-3 proteins, a novel family of evolutionarily conserved RNA-binding proteins differentially localized to processing bodies.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.