Property Summary

NCBI Gene PubMed Count 4
PubMed Score 4.14
PubTator Score 1.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma 1.200 2.0e-03
atypical teratoid / rhabdoid tumor 2.600 2.6e-07
Breast cancer 1.400 1.1e-04
breast carcinoma 1.100 9.9e-03
ductal carcinoma in situ 1.100 8.0e-03
ependymoma 1.700 4.1e-10
fibroadenoma 1.400 4.9e-02
glioblastoma 1.700 4.1e-06
group 3 medulloblastoma 3.700 1.9e-08
invasive ductal carcinoma 1.300 1.0e-02
lung adenocarcinoma 2.300 8.2e-10
medulloblastoma, large-cell 3.600 6.2e-07
oligodendroglioma 1.100 1.1e-12
osteosarcoma 1.302 3.7e-02
ovarian cancer 1.400 6.8e-05
primitive neuroectodermal tumor 3.300 9.7e-07
urothelial carcinoma 1.400 1.5e-02

AA Sequence

MPSLVVSGIMERNGGFGELGCFGGSAKDRGLLEDERALQLALDQLCLLGLGEPPAPTAGEDGGGGGGGAP      1 - 70
AQPAAPPQPAPPPPPAAPPAAPTAAPAAQTPQPPTAPKGASDAKLCALYKEAELRLKGSSNTTECVPVPT     71 - 140
SEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFMVTGRREDVATARREIISAAEHFSMIRASRNKS    141 - 210
GAAFGVAPALPGQVTIRVRVPYRVVGLVVGPKGATIKRIQQQTNTYIITPSRDRDPVFEITGAPGNVERA    211 - 280
REEIETHIAVRTGKILEYNNENDFLAGSPDAAIDSRYSDAWRVHQPGCKPLSTFRQNSLGCIGECGVDSG    281 - 350
FEAPRLGEQGGDFGYGGYLFPGYGVGKQDVYYGVAETSPPLWAGQENATPTSVLFSSASSSSSSSAKARA    351 - 420
GPPGAHRSPATSAGPELAGLPRRPPGEPLQGFSKLGGGGLRSPGGGRDCMVCFESEVTAALVPCGHNLFC    421 - 490
MECAVRICERTDPECPVCHITATQAIRIFS                                            491 - 520
//

Text Mined References (5)

PMID Year Title