Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ulcerative colitis 2087 1.14156912572548E-5
nasopharyngeal carcinoma 1056 1.8164480994449E-5
medulloblastoma, large-cell 6234 2.78817642557193E-5
atypical teratoid/rhabdoid tumor 1095 2.81090114125621E-5
osteosarcoma 7933 1.09848299683862E-4
primitive neuroectodermal tumor 3031 0.00108954884177674
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00118185709504883
inflammatory breast cancer 404 0.00538682287525644
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00977452326895529
group 4 medulloblastoma 1875 0.0178355325675029
spina bifida 1064 0.0360372103609784

Expression

Synonym

Accession A1IGU5 Q6ZW51
Symbols

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

AA Sequence

MAKHGADEPSSRSGSPDREGRASEDRSLLHQRLAVRELIDTEVSYLHMLQLCASDIRSRLQQLPQGDLDV      1 - 70
LFSNIDDIIKVNSRFLHDLQETASKEEEQVQLVGNIFLEFQEELEQVYKVYCASYDQALLLVDTYRKEPE     71 - 140
LQRHIQGIVEAVVPQAGSSGLSFLLVIPLQRITRYPLLLQKILENTVPDASAYPVLQRAVSALQDVNTNI    141 - 210
NEYKMRKEVASKYTKVEQLTLRERLARINTHTLSKKTTRLSQLLKQEAGLIPRTEDKEFDDLEERFQWVS    211 - 280
LCVTELKNNVAAYLDNLQAFLYFRPHEYNLDIPEGPAVQYCNLARDLHLEAFLKFKQRLEGLVWQPLCSL    281 - 350
AKALLGPQNLIKKRLDKLLDFERVEEKLLEVGSVTYQEEAARHTYQALNSLLVAELPQFNQLVMQWLGQI    351 - 420
MCTFVTLQRDLAKQVLQRAEGSMAQLPHHHVPEPAFRKLVEDALGRTSNQLRSFQETFEKVQPPPTTQPL    421 - 490
LPGSERQVQALLSRYGPGKLYQVTSNISGTGTLDLTLPRGQIVAILQNKDTKGNSGRWLVDTGGHRGYVP    491 - 560
AGKLQLYHVVPSAEELRRQAGLNKDPRCLTPEPSPALVPSIPTMNQVIAAYPFVARSSHEVSLQAGQPVT    561 - 630
ILEAQDKKGNPEWSLVEVNGQRGYVPSGFLARARSPVLWGWSLPS                             631 - 675
//

Text Mined References (3)

PMID Year Title
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.