Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 1.4e-04
Breast cancer -1.300 1.9e-06
group 4 medulloblastoma -1.200 1.8e-02
intraductal papillary-mucinous adenoma (... 1.800 1.2e-03
intraductal papillary-mucinous carcinoma... 1.400 9.8e-03
medulloblastoma, large-cell -1.800 2.8e-05
nasopharyngeal carcinoma -1.300 1.8e-05
osteosarcoma -3.358 1.1e-04
primitive neuroectodermal tumor -1.200 1.1e-03
spina bifida -2.359 3.6e-02
ulcerative colitis -1.500 1.1e-05

AA Sequence

MAKHGADEPSSRSGSPDREGRASEDRSLLHQRLAVRELIDTEVSYLHMLQLCASDIRSRLQQLPQGDLDV      1 - 70
LFSNIDDIIKVNSRFLHDLQETASKEEEQVQLVGNIFLEFQEELEQVYKVYCASYDQALLLVDTYRKEPE     71 - 140
LQRHIQGIVEAVVPQAGSSGLSFLLVIPLQRITRYPLLLQKILENTVPDASAYPVLQRAVSALQDVNTNI    141 - 210
NEYKMRKEVASKYTKVEQLTLRERLARINTHTLSKKTTRLSQLLKQEAGLIPRTEDKEFDDLEERFQWVS    211 - 280
LCVTELKNNVAAYLDNLQAFLYFRPHEYNLDIPEGPAVQYCNLARDLHLEAFLKFKQRLEGLVWQPLCSL    281 - 350
AKALLGPQNLIKKRLDKLLDFERVEEKLLEVGSVTYQEEAARHTYQALNSLLVAELPQFNQLVMQWLGQI    351 - 420
MCTFVTLQRDLAKQVLQRAEGSMAQLPHHHVPEPAFRKLVEDALGRTSNQLRSFQETFEKVQPPPTTQPL    421 - 490
LPGSERQVQALLSRYGPGKLYQVTSNISGTGTLDLTLPRGQIVAILQNKDTKGNSGRWLVDTGGHRGYVP    491 - 560
AGKLQLYHVVPSAEELRRQAGLNKDPRCLTPEPSPALVPSIPTMNQVIAAYPFVARSSHEVSLQAGQPVT    561 - 630
ILEAQDKKGNPEWSLVEVNGQRGYVPSGFLARARSPVLWGWSLPS                             631 - 675
//

Text Mined References (3)

PMID Year Title